BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B17 (629 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0328 + 2553850-2553902,2553990-2554050,2554163-2554321 119 2e-27 02_01_0082 - 564946-565075,565164-565384,565662-565916 29 4.0 12_01_0515 + 4081373-4081622,4081725-4081867,4082061-4082219,408... 28 5.3 09_06_0257 + 21891523-21891578,21891911-21892421,21893021-218930... 28 5.3 11_04_0096 + 13435988-13436803,13436880-13437053,13437673-134378... 27 9.3 07_03_0932 + 22726529-22727338,22729097-22729462,22729841-22730026 27 9.3 >03_01_0328 + 2553850-2553902,2553990-2554050,2554163-2554321 Length = 90 Score = 119 bits (286), Expect = 2e-27 Identities = 44/68 (64%), Positives = 60/68 (88%) Frame = +2 Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301 QIQYSE+Y DD YEYRHV+LPP++A+++PK+ L++E EWR +GVQQS GW+H+ +H PEP Sbjct: 3 QIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEP 62 Query: 302 HVLLFRRP 325 H++LFRRP Sbjct: 63 HIMLFRRP 70 >02_01_0082 - 564946-565075,565164-565384,565662-565916 Length = 201 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 407 RHIFRCH----SLILFKLLIETIIVKTKKKNCSIYYKLADINYYY 529 +H +RCH L +E + ++ K+K ++YKLA +N+ Y Sbjct: 85 KHSWRCHVEPPPNALETAEVEALKLEVKQKKEELFYKLATLNWQY 129 >12_01_0515 + 4081373-4081622,4081725-4081867,4082061-4082219, 4082339-4082518,4082616-4082845,4082959-4083099, 4083366-4083420 Length = 385 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +2 Query: 107 VMPVDQIQYSERYTDDVYEY--RHVILPPDIARMVP---KSHLMTETEWRNLGVQQSP 265 + P D S +Y + E+ R+ PP +A + K+ + +EW+N GVQ P Sbjct: 95 LFPCDVTDESPQYHAYLQEFYRRNCSAPPSVAAAISLCLKNERILRSEWQNRGVQVHP 152 >09_06_0257 + 21891523-21891578,21891911-21892421,21893021-21893092, 21893571-21893875,21894085-21894196,21894514-21894750, 21894933-21895640 Length = 666 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 234 SGETLVFSRVPAGSTLWCTILNPMFYYL 317 S L+++RV GS L+ ++P FYYL Sbjct: 73 SSMVLMWNRVFLGSCLFALFIDPFFYYL 100 >11_04_0096 + 13435988-13436803,13436880-13437053,13437673-13437834, 13438548-13438690,13439059-13439134,13439231-13439403, 13439482-13439563,13439949-13440026,13440369-13440461, 13441026-13441187,13441225-13441530,13442265-13442369, 13443097-13443243 Length = 838 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 215 HLMTETEWRNLGVQQSPGWLHFMVHNPEPH 304 H MT +WRN+G Q P F PH Sbjct: 736 HGMTIAQWRNMGYQNQPEHQQFAQLLQAPH 765 >07_03_0932 + 22726529-22727338,22729097-22729462,22729841-22730026 Length = 453 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 83 LFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220 LFDA+ + +PV Y E +DV +YR++ + + ++ V L Sbjct: 326 LFDALVSLCVPVIVSDYIELPFEDVIDYRNISIFVETSKAVQPGFL 371 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,939,519 Number of Sequences: 37544 Number of extensions: 306282 Number of successful extensions: 651 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -