BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B14 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 143 6e-35 At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ... 141 3e-34 At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) cont... 134 3e-32 At1g01010.1 68414.m00001 no apical meristem (NAM) family protein... 28 3.7 At5g36210.1 68418.m04365 expressed protein 27 6.4 At5g34930.1 68418.m04119 arogenate dehydrogenase identical to ar... 27 8.5 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 143 bits (347), Expect = 6e-35 Identities = 78/163 (47%), Positives = 101/163 (61%), Gaps = 6/163 (3%) Frame = +2 Query: 56 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235 M++ + NR I +YLFKEGV+ AKKD++ P+H +E +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60 Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG-RPDAPARS---- 400 AW H+YW+LTNEGI++LR +L+LP EIVPATLK+ + G G RP P R Sbjct: 61 AWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKKQQKPLGRPFGGGGDRPRGPPRGDGER 120 Query: 401 -AEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGR 526 DR YR P + G + KA P F+GG G R Sbjct: 121 RFGDRDGYRGGPKSGG--EYGDKAG-APADYQPGFRGGAGGAR 160 >At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ribosomal protein S10 - Lumbricus rubellus, PID:e1329701 Length = 177 Score = 141 bits (341), Expect = 3e-34 Identities = 77/158 (48%), Positives = 100/158 (63%), Gaps = 3/158 (1%) Frame = +2 Query: 56 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235 M++ + NR I +YLFKEGV AKKD++ PKH ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT-ETVRRGPVG-RPDAPARSAED 409 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + GP G R P RS D Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRQRGPPRSDGD 119 Query: 410 RSAY-RRTPAAPGVAPHDKKADVGPGSADLEFKGGYGR 520 R + R G D+K P F+GG GR Sbjct: 120 RPRFGDRDGYRGGPRGGDEKGG-APADFQPSFQGGGGR 156 >At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) contains similarity to 40S ribosomal protein S10 Length = 179 Score = 134 bits (325), Expect = 3e-32 Identities = 77/167 (46%), Positives = 100/167 (59%), Gaps = 11/167 (6%) Frame = +2 Query: 56 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235 M++ + NR I +YLFKEGV AKKD++ KH ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISEANRKEICKYLFKEGVCFAKKDFNLAKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT-ETVRRGPVG-RPDAPARSA-- 403 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + GP G R P Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRSRGPRHEGGD 119 Query: 404 ----EDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKG---GYGRG 523 DR YR P A G +K P F+G G+GRG Sbjct: 120 RPRFGDRDGYRAGPRAGGEFGGEKGG--APADYQPSFQGSGRGFGRG 164 >At1g01010.1 68414.m00001 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana] Length = 429 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 143 PKHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232 P HT ++ IP+L +I+ + + K++ K+Q Sbjct: 333 PGHTRIDDIPSLNIIEPLHNYKAQEQPKQQ 362 >At5g36210.1 68418.m04365 expressed protein Length = 676 Score = 27.5 bits (58), Expect = 6.4 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 53 KMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKH 151 K++ P Q+R IYE L K+G+ VA +Y +H Sbjct: 603 KVVTPDQSR-KIYEALKKKGLPVALVEYEGEQH 634 >At5g34930.1 68418.m04119 arogenate dehydrogenase identical to arogenate dehydrogenase GI:16903098 from [Arabidopsis thaliana]; contains Pfam profile: PF02153: prephenate dehydrogenase Length = 640 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 148 LRCMIVFFGHHDSLFKEVLINSNTVLFGH 62 LR I+ FG++ E LI+ +LF H Sbjct: 53 LRIAIIGFGNYGQFLAETLISQGHILFAH 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,506,393 Number of Sequences: 28952 Number of extensions: 224991 Number of successful extensions: 609 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -