BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B08 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27350.1 68414.m03331 expressed protein contains 1 transmembr... 56 1e-08 At1g27330.1 68414.m03329 expressed protein similar to EST gb|AA6... 56 1e-08 At3g07650.2 68416.m00917 zinc finger (B-box type) family protein... 29 1.4 At3g07650.1 68416.m00916 zinc finger (B-box type) family protein... 29 1.4 At1g31960.1 68414.m03929 hypothetical protein 29 2.4 At5g48250.1 68418.m05961 zinc finger (B-box type) family protein... 28 4.2 At1g27595.1 68414.m03365 expressed protein similar to Symplekin ... 27 5.5 At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, pu... 27 7.3 >At1g27350.1 68414.m03331 expressed protein contains 1 transmembrane domain; similar to ribosome associated membrane protein RAMP4 GI:4585827 [Rattus norvegicus]; similar to ESTs gb|T20610 and gb|AA586199 Length = 68 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279 KNI RG VP+TT +K YPV P LL F+FVV GS++FQII++ Sbjct: 17 KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61 >At1g27330.1 68414.m03329 expressed protein similar to EST gb|AA650671 and gb|T20610 Length = 68 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279 KNI RG VP+TT +K YPV P LL F+FVV GS++FQII++ Sbjct: 17 KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 61 >At3g07650.2 68416.m00917 zinc finger (B-box type) family protein similar to zinc finger protein GB:BAA33206 [Oryza sativa] Length = 372 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 150 HHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCV 263 +++ T Q KR+ ISC + P S L S+W C+ Sbjct: 82 NNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCL 119 >At3g07650.1 68416.m00916 zinc finger (B-box type) family protein similar to zinc finger protein GB:BAA33206 [Oryza sativa] Length = 372 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 150 HHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCV 263 +++ T Q KR+ ISC + P S L S+W C+ Sbjct: 82 NNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCL 119 >At1g31960.1 68414.m03929 hypothetical protein Length = 173 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 480 NPVSVKETSSHDCTVKGTNGRLRKHSL 400 NP S++ D VKG+NG +R HS+ Sbjct: 105 NPTSIRRKLFDDAGVKGSNGVVRFHSV 131 >At5g48250.1 68418.m05961 zinc finger (B-box type) family protein contains similarity to CONSTANS homologs Length = 373 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 153 HNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDN 272 H+ T KR+ I+C + P S L S+W C+ N Sbjct: 76 HDGKNSTTTSHHKRQTINCYSGCPSSAELSSIWSFCMDLN 115 >At1g27595.1 68414.m03365 expressed protein similar to Symplekin (SP:Q92797) {Homo sapiens} Length = 1091 Score = 27.5 bits (58), Expect = 5.5 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 324 ENTIK*QHYPSKVRHNLHQHLF--VDMRESVFGGGH*YL*LCNRGLMSLSHLQGXNGTPI 497 ++TI + P +VRHN + HL V ES+ G + G+ S +HL TP+ Sbjct: 160 DDTINGEVAPKRVRHNTNMHLTQQVQTNESLQGP------VSINGISSGNHLSDSELTPV 213 Query: 498 HKVI 509 +++ Sbjct: 214 EQMV 217 >At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, putative similar to mdr-like P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; contains Pfam profiles PF00005: ABC transporter and PF00664: ABC transporter transmembrane region; identical to cDNA MDR-like p-glycoprotein (At3g28860) GI:24324261 Length = 1252 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -2 Query: 188 SLVVLGTFPLIVMFLLAISLAIR 120 SL++LGTFPL+V+ A L+++ Sbjct: 833 SLLILGTFPLLVLANFAQQLSLK 855 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,162,916 Number of Sequences: 28952 Number of extensions: 232261 Number of successful extensions: 532 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -