BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_B03 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.54 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.2 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 6.6 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.8 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 23 8.8 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.6 bits (56), Expect = 0.54 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 341 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 442 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 326 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 469 KH C + +E +++ KEA +T+NL + +A + GT Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 240 VTLYTRPVFPWYTLCGIP 187 V ++ RP PW+++ GIP Sbjct: 73 VGIFGRPGRPWWSVPGIP 90 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 304 DALRYNPSANTLVDNHTESMSSHVVH 227 DA+R + + +V NH E S+ +H Sbjct: 3072 DAIRIGSNESIVVPNHMERSSASSLH 3097 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 22.6 bits (46), Expect = 8.8 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = +2 Query: 227 VYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 382 ++ + H GV+V+ + R + EH++H R K + NE++ Sbjct: 117 LFQIGQHVRGVLVSIKSRMMAYTNDAVAKFEHLRHRTMRAVKRKMDELNEQI 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,624 Number of Sequences: 2352 Number of extensions: 11173 Number of successful extensions: 58 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -