BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_A21 (651 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094922-1|AAM11275.1| 198|Drosophila melanogaster RH38235p pro... 29 7.2 AE013599-3601|AAF47001.2| 246|Drosophila melanogaster CG9812-PC... 29 7.2 AE013599-3600|AAF47002.2| 198|Drosophila melanogaster CG9812-PB... 29 7.2 >AY094922-1|AAM11275.1| 198|Drosophila melanogaster RH38235p protein. Length = 198 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 152 YIALLTILIISQVYSAP-QFITFKDGKIGVNF 244 ++ L + ++ P Q TF+DGK+GVNF Sbjct: 2 FVLLGALCLLQTASLVPAQLFTFRDGKVGVNF 33 >AE013599-3601|AAF47001.2| 246|Drosophila melanogaster CG9812-PC, isoform C protein. Length = 246 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 152 YIALLTILIISQVYSAP-QFITFKDGKIGVNF 244 ++ L + ++ P Q TF+DGK+GVNF Sbjct: 2 FVLLGALCLLQTASLVPAQLFTFRDGKVGVNF 33 >AE013599-3600|AAF47002.2| 198|Drosophila melanogaster CG9812-PB, isoform B protein. Length = 198 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 152 YIALLTILIISQVYSAP-QFITFKDGKIGVNF 244 ++ L + ++ P Q TF+DGK+GVNF Sbjct: 2 FVLLGALCLLQTASLVPAQLFTFRDGKVGVNF 33 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,113,660 Number of Sequences: 53049 Number of extensions: 286558 Number of successful extensions: 732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -