BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_A16 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) 32 0.47 SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49185| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_26573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 29 4.4 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 29 4.4 SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) 28 5.8 SB_59294| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.20004e-41) 28 5.8 SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10) 28 5.8 SB_36951| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9) 28 7.6 SB_41314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) Length = 235 Score = 31.9 bits (69), Expect = 0.47 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = +2 Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313 PVY + N+++VP + S PG L LL S + YN Q ++ ++ + V A ++ Sbjct: 31 PVYEVNNIESVPFPGIISS--PGDLFPLLPDSIR---FIYNAQISKCEEHLSVKLAHLMS 85 Query: 314 LI 319 L+ Sbjct: 86 LV 87 >SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 31.5 bits (68), Expect = 0.62 Identities = 19/72 (26%), Positives = 38/72 (52%) Frame = +2 Query: 200 GGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVFEL 379 G +RLL+GS + V Y+LQ +V + +PIL L +D ++++++ L ++ Sbjct: 242 GAYKRLLSGSIDRNVKVYDLQDYKVVHSMDY-PSPILSLAVSDDVVVSEKRKTYLNKYDK 300 Query: 380 TNSGYEEDAVIE 415 +E A ++ Sbjct: 301 LVKNFEYAAALD 312 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 344 QEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASL-YVPEKDYKINIYNFNGE 520 QE+GG+L + L +S ++DY RF TKLA+ Y+PE K+ I NF Sbjct: 1793 QEQGGRLLI-RLGDS--------DIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVT 1843 Query: 521 KLG 529 K G Sbjct: 1844 KSG 1846 >SB_664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1046 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = +2 Query: 194 LPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQE--KGGKLK 367 L GG+ +++G K GYVY + + Q + + HT H IT++ + ++ Sbjct: 273 LLGGMCVMVSGPKEGYVYDIYNKAMLLSQYKYTSDTIKVSVCHTLLHAITKQGLETYTVR 332 Query: 368 VFELTNSGYEEDAVIEVDYPGFCRFEANTKLAS 466 ++ + G D V++ + + +K+AS Sbjct: 333 MYAAASQGLRTDRVLQHNLSSMQNEKKESKIAS 365 >SB_49185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 600 HGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505 +G S++F TSP + D ++ +EPS +P L Sbjct: 112 YGGSISFEDETSPRYYDNNNTYEEPSLTPAAL 143 >SB_26573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -3 Query: 630 RNQLVXQGLSHGNSMNFRHITSPSF-TDASSYSKEPSFSP-LKL*MFIL*SFSGT*SDAS 457 RN+ + QG+S G+ N H + SF + A++ +++ F P +K+ IL S G D Sbjct: 23 RNKDLGQGVSLGDDYNIAHWVNHSFYSSANAKTQQDEFVPRIKVPDVILNSIGGDVQDNP 82 Query: 456 F 454 F Sbjct: 83 F 83 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -3 Query: 630 RNQLVXQGLSHGNSMNFRHITSPSF-TDASSYSKEPSFSP-LKL*MFIL*SFSGT*SDAS 457 RN+ + QG+S G+ N H + SF + A++ +++ F P +K+ IL S G D Sbjct: 153 RNKDLGQGVSLGDDYNIAHWVNHSFYSSANAKTQQDEFVPRIKVPDVILNSIGGDVQDNP 212 Query: 456 F 454 F Sbjct: 213 F 213 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 600 HGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505 +G S++F TSP + D ++ +EPS +P L Sbjct: 1693 YGGSISFEDETSPRYYDNNNTYEEPSLTPAAL 1724 >SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) Length = 539 Score = 28.3 bits (60), Expect = 5.8 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = +2 Query: 290 VGQAPILHLIHT-DSHLITQEKGGKLKVFEL-TNSGYEEDAVIEVDYPGFCRFEANTKLA 463 VG +H + T +HLI+ ++G LKV+++ T Y E + C +T L Sbjct: 92 VGHDKDVHCLLTFGAHLISVDEGSSLKVWDIKTTELYLEVGFDSKTFHITCLMHPSTYLN 151 Query: 464 SLYVPEKDYKINIYNFNGEKLGSLEYDDASVKL 562 + + K + I+N +YD+A+V + Sbjct: 152 KILLCSKQGSMQIWNI------KTKYDNATVNV 178 >SB_59294| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.20004e-41) Length = 851 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 467 LYVPE-KDYKINIYNFNGEKLGSLEYDDASVKLGDVMCLKFIEFPCDRPXSTSWL 628 ++V E KD + ++ F E L S Y D ++ ++CL +I DR + +WL Sbjct: 624 MFVDEFKDAEFHLRRFESEPLPSQTYKDFLLQFQKMVCLDYIIRNTDR-GNDNWL 677 >SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 120 ASSGILFTLSEMSIMCQFIHWLSVFYP 200 ASSG+ S++ I CQ + WL YP Sbjct: 44 ASSGVSSRASDIHIGCQIVWWLDDRYP 70 >SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10) Length = 1378 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/52 (25%), Positives = 19/52 (36%) Frame = +1 Query: 109 KMALLPPXSCLHYPKCR*CASLFTGFQFFTRGLREVTSRFEKRLCLRIQPPD 264 K + P C Y KC C G+ V ++ +C + PPD Sbjct: 465 KKNVTPRSYCQMYHKCEACGKRIDMVAIQKEGVSHVCGEYKCTVCKEVVPPD 516 >SB_36951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 329 SHLITQEKGGKLKVFELTNSGYEEDAV 409 +HLI QE+ L++ EL ++ Y++DA+ Sbjct: 12 AHLIKQEEKVNLELRELQHTAYDDDAI 38 >SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9) Length = 433 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 287 VSSAELYLSGGCMRKHNRFSNRLVTSLSPRVKN*KPVNKLAHYRH 153 ++S +L GC N+F N L TS+ + K +NKL ++H Sbjct: 89 MASINTHLDSGC----NKFGNELNTSIKSGIGVEKRINKLDVHKH 129 >SB_41314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1388 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/52 (25%), Positives = 18/52 (34%) Frame = +1 Query: 109 KMALLPPXSCLHYPKCR*CASLFTGFQFFTRGLREVTSRFEKRLCLRIQPPD 264 K + P C Y KC C G V ++ +C + PPD Sbjct: 475 KKNVTPRSYCQMYHKCETCGKRIDMIAIQKEGTSHVCGEYKCTVCKEVVPPD 526 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,058,569 Number of Sequences: 59808 Number of extensions: 341394 Number of successful extensions: 748 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -