BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_A16 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 2.1 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 8.4 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 2.1 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +2 Query: 278 QKIQVGQAPILHLIHTDSHLITQEKGGKLKV------FELTNSGYEEDAVIEVDYPGFC 436 +K++VGQ+ IL ++H +T+E K+KV E+TN I+ P C Sbjct: 398 RKVKVGQSKILLILHEP---LTKEDWIKIKVEKADQTIEITNIKRRNPYTIQFSVPEVC 453 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 618 VXQGLSHGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505 + L+ N H+T P F SS S P+ L L Sbjct: 354 IITSLNQNRGTNKMHLTVPKFNVFSSLSLVPALKHLGL 391 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,680 Number of Sequences: 2352 Number of extensions: 11685 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -