BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_A15 (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37831| Best HMM Match : MAM (HMM E-Value=0) 30 0.63 SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) 30 0.63 SB_45686| Best HMM Match : T-box (HMM E-Value=0) 27 4.5 >SB_37831| Best HMM Match : MAM (HMM E-Value=0) Length = 563 Score = 30.3 bits (65), Expect = 0.63 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 113 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223 G G + Q QV + + GET + ++ V+G GDI Sbjct: 151 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 187 >SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) Length = 89 Score = 30.3 bits (65), Expect = 0.63 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 113 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223 G G + Q QV + + GET + ++ V+G GDI Sbjct: 22 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 58 >SB_45686| Best HMM Match : T-box (HMM E-Value=0) Length = 947 Score = 27.5 bits (58), Expect = 4.5 Identities = 18/36 (50%), Positives = 20/36 (55%) Frame = -1 Query: 259 PPSFTFRFKKSEDVSVTDGSFHVSDDLTAGLPNELD 152 P S RFK SED T SF SD++ G P ELD Sbjct: 568 PSSSPKRFKTSEDEEPTAQSFE-SDEI-PGSPEELD 601 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,182,957 Number of Sequences: 59808 Number of extensions: 224495 Number of successful extensions: 554 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -