BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_A08 (614 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75533-9|CAA99814.2| 772|Caenorhabditis elegans Hypothetical pr... 28 6.1 AF067949-1|AAC19236.2| 1446|Caenorhabditis elegans Suppressor of... 28 6.1 >Z75533-9|CAA99814.2| 772|Caenorhabditis elegans Hypothetical protein C54G4.1a protein. Length = 772 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = -3 Query: 474 RVFDHEIKDIIAELLCTDFEEAALGLSVSPEIQS---ICSL-WDRACPRCTKPLGIPRV 310 + D + +D I +LL E+ LG + EI++ + S+ WD A R KP+ +PR+ Sbjct: 248 KTMDVDARDFIGQLLEKKLEKR-LGYNGVDEIKNHKFMSSIDWDAAVKRTLKPVIVPRI 305 >AF067949-1|AAC19236.2| 1446|Caenorhabditis elegans Suppressor of constitutive dauerformation protein 2 protein. Length = 1446 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 531 PXCYCKNREQHDWLYRPQCFPWCP 602 P CYC RE+H L + +C W P Sbjct: 153 PDCYCGKREKHCDLSKEKCH-WTP 175 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,361,063 Number of Sequences: 27780 Number of extensions: 271986 Number of successful extensions: 846 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -