Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner12d18r
         (407 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF457551-1|AAL68781.1|  406|Anopheles gambiae calreticulin protein.    23   3.2  
AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.        22   7.5  
AY341191-1|AAR13755.1|  191|Anopheles gambiae GNBP B1 protein.         22   9.9  
AY341190-1|AAR13754.1|  191|Anopheles gambiae GNBP B1 protein.         22   9.9  
AY341189-1|AAR13753.1|  191|Anopheles gambiae GNBP B1 protein.         22   9.9  
AY341188-1|AAR13752.1|  191|Anopheles gambiae GNBP B1 protein.         22   9.9  
AJ001042-1|CAA04496.1|  395|Anopheles gambiae putative gram nega...    22   9.9  
AF081533-1|AAD29854.1|  395|Anopheles gambiae putative gram nega...    22   9.9  

>AF457551-1|AAL68781.1|  406|Anopheles gambiae calreticulin protein.
          Length = 406

 Score = 23.4 bits (48), Expect = 3.2
 Identities = 8/19 (42%), Positives = 11/19 (57%)
 Frame = -1

Query: 80  WEPLMAKPPKGQWEWPPSK 24
           WEP M   P+ + EW P +
Sbjct: 258 WEPPMIDNPEYKGEWKPKQ 276


>AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 7.5
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -2

Query: 328 PQIRITLWAPYMVKSYVLSKKCQKHQFIVNIRN 230
           PQ+R  L  P        +K+C +H  +V+ R+
Sbjct: 12  PQMRDYLSPPKTTACTAGNKRCCRHPLLVDFRD 44


>AY341191-1|AAR13755.1|  191|Anopheles gambiae GNBP B1 protein.
          Length = 191

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 164 AKLPTGDWLWP 174


>AY341190-1|AAR13754.1|  191|Anopheles gambiae GNBP B1 protein.
          Length = 191

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 164 AKLPTGDWLWP 174


>AY341189-1|AAR13753.1|  191|Anopheles gambiae GNBP B1 protein.
          Length = 191

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 164 AKLPTGDWLWP 174


>AY341188-1|AAR13752.1|  191|Anopheles gambiae GNBP B1 protein.
          Length = 191

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 164 AKLPTGDWLWP 174


>AJ001042-1|CAA04496.1|  395|Anopheles gambiae putative gram
           negative bacteria bindingprotein protein.
          Length = 395

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 182 AKLPTGDWLWP 192


>AF081533-1|AAD29854.1|  395|Anopheles gambiae putative gram
           negative bacteria bindingprotein protein.
          Length = 395

 Score = 21.8 bits (44), Expect = 9.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 65  AKPPKGQWEWP 33
           AK P G W WP
Sbjct: 182 AKLPTGDWLWP 192


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 372,479
Number of Sequences: 2352
Number of extensions: 6025
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 32922351
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)