Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner12c20r
         (312 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-415|AAF47615.1|  485|Drosophila melanogaster CG13810-PA...    27   4.9  

>AE014296-415|AAF47615.1|  485|Drosophila melanogaster CG13810-PA
           protein.
          Length = 485

 Score = 27.1 bits (57), Expect = 4.9
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = +3

Query: 57  TLXYLPTENYHASSTKGAILIIAHTYSKRYYAIDSVLACLTFFFHRIYSFSKGQSEHFCD 236
           T  Y+P   Y A ++ GA+L++ +T  K  Y +  ++  +T     +  +S  QSEH C 
Sbjct: 272 TQLYIPFVLYSAGTSFGALLLMRYT-PKLVYLLFGLIQ-ITSIVALLCIYSDEQSEH-CF 328

Query: 237 *LIC 248
             +C
Sbjct: 329 LFLC 332


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,653,393
Number of Sequences: 53049
Number of extensions: 217162
Number of successful extensions: 476
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 470
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 476
length of database: 24,988,368
effective HSP length: 74
effective length of database: 21,062,742
effective search space used: 610819518
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)