Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner12c09r
         (746 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    23   4.0  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      22   7.0  

>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 9/46 (19%), Positives = 20/46 (43%)
 Frame = +1

Query: 604 HQIGNLEQSCSWRTLLFVYQTGCVHQPANPGSLVLLQRLQLDXPSP 741
           H+  +  +   W  ++F+Y   C+ + + P      +  +   PSP
Sbjct: 320 HRNADTHEMSEWVKVVFLYWLPCILRMSRPSDKEEREAQKSQKPSP 365


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 3   HHYISHHRVL 32
           HH++ HH+VL
Sbjct: 73  HHHLHHHQVL 82


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 218,957
Number of Sequences: 438
Number of extensions: 5349
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23388480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)