SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11p11r
         (737 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.              23   3.0  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    21   9.1  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    21   9.1  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    21   9.1  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    21   9.1  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    21   9.1  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    21   9.1  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    21   9.1  

>DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 10/34 (29%), Positives = 15/34 (44%)
 Frame = -2

Query: 361 TA*NFINLTSLKNINLDSTKYFLFVNCAFKSLKI 260
           TA   I+  +   IN+D     LF+ C  K   +
Sbjct: 39  TAQQIIDDINEGKINMDDENVLLFIECTMKKFNV 72


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 82  SSLSNNTIHN 91


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 82  SSLSNNTIHN 91


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 83  SSLSNNTIHN 92


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 83  SSLSNNTIHN 92


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 83  SSLSNNTIHN 92


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 83  SSLSNNTIHN 92


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = -3

Query: 684 SALNNNTLHN 655
           S+L+NNT+HN
Sbjct: 316 SSLSNNTIHN 325


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,359
Number of Sequences: 438
Number of extensions: 3884
Number of successful extensions: 15
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23023035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -