BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fner11p11r
(737 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 23 3.0
DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 9.1
DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 9.1
DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 9.1
DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 9.1
DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 9.1
DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 9.1
AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.1
>DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein.
Length = 135
Score = 23.0 bits (47), Expect = 3.0
Identities = 10/34 (29%), Positives = 15/34 (44%)
Frame = -2
Query: 361 TA*NFINLTSLKNINLDSTKYFLFVNCAFKSLKI 260
TA I+ + IN+D LF+ C K +
Sbjct: 39 TAQQIIDDINEGKINMDDENVLLFIECTMKKFNV 72
>DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 82 SSLSNNTIHN 91
>DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 82 SSLSNNTIHN 91
>DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 83 SSLSNNTIHN 92
>DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 83 SSLSNNTIHN 92
>DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 83 SSLSNNTIHN 92
>DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 83 SSLSNNTIHN 92
>AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex
determiner protein.
Length = 406
Score = 21.4 bits (43), Expect = 9.1
Identities = 7/10 (70%), Positives = 10/10 (100%)
Frame = -3
Query: 684 SALNNNTLHN 655
S+L+NNT+HN
Sbjct: 316 SSLSNNTIHN 325
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,359
Number of Sequences: 438
Number of extensions: 3884
Number of successful extensions: 15
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23023035
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -