SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11p09r
         (729 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       22   5.2  
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    22   5.2  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   9.0  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -1

Query: 129 DWLKRMSYTNK 97
           DW K +SYTNK
Sbjct: 4   DWGKTVSYTNK 14


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
            protein.
          Length = 1308

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -2

Query: 632  RAMDTQQVVQEVTKMMVTAAEWAGRVTPVTEQQSPH 525
            R +  QQ   + + M    A+  G+   V  QQSPH
Sbjct: 1068 RVVTNQQQSIQTSGMQRIIAQIGGKPIAVQIQQSPH 1103


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +3

Query: 609  HLLSIHSPPHN 641
            H L +H+PPH+
Sbjct: 1359 HQLIVHAPPHS 1369


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,818
Number of Sequences: 438
Number of extensions: 3137
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22657590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -