Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11n11f
         (623 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6CXY4 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    34   2.4  

>UniRef50_Q6CXY4 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome A of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 88

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 11/49 (22%), Positives = 29/49 (59%)
 Frame = -1

Query: 557 SNPTITVYVLFFRWYQLSILFIREQNVRRLDLTSEVMLIEQETDYSVIL 411
           S PT++ ++    +Y   +LF+R +++R+  + + + +I  +T +  +L
Sbjct: 24  STPTVSAFIFLIFFYISGLLFLRNESIRKEGIAAAMFIISTDTTHHFVL 72


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 500,882,354
Number of Sequences: 1657284
Number of extensions: 8808560
Number of successful extensions: 19536
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19526
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 45636850930
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)