Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11m10r
         (724 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q98RL3 Cluster: Putative transcription factor subunit; ...    33   9.4  

>UniRef50_Q98RL3 Cluster: Putative transcription factor subunit;
           n=1; Guillardia theta|Rep: Putative transcription factor
           subunit - Guillardia theta (Cryptomonas phi)
          Length = 330

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/66 (24%), Positives = 33/66 (50%)
 Frame = +2

Query: 512 FLCYVQLNNSLAVREVTYVQ*CLIRSLKISILHALFEISYAKLKMLHYDWSIKAKF*YXF 691
           F+ Y  LN ++ + ++ +++   +    I+   +L +I Y  +    Y++  K K  Y F
Sbjct: 45  FINYHNLNKNIILLKIFFLRNSNVVQKSINSRRSLLKIKYKSINDFEYNYKKKLKILYKF 104

Query: 692 NSLCSN 709
           NS+  N
Sbjct: 105 NSIFLN 110


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 577,400,715
Number of Sequences: 1657284
Number of extensions: 10164684
Number of successful extensions: 16514
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16511
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58677691418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)