SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11e12r
         (757 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000150ABCD Cluster: hypothetical protein TTHERM_0082...    33   5.8  

>UniRef50_UPI000150ABCD Cluster: hypothetical protein
           TTHERM_00824040; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00824040 - Tetrahymena
           thermophila SB210
          Length = 2045

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +2

Query: 485 KQKLKFNATSKLHRPFDRRIHYLTSQNFLA*RSGNQAIITLLQKKNCGWTYWTIRKHSLG 664
           K+++KFN    ++R F  R  +   + F+    GNQ        +N  ++Y T+ KH L 
Sbjct: 124 KKEIKFNDIMMMNRGFSNRNQFAMQEEFINFGVGNQLGGVNSMSENQLYSYVTLNKHPLN 183

Query: 665 HISI 676
            + +
Sbjct: 184 SLKV 187


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 630,999,271
Number of Sequences: 1657284
Number of extensions: 11845915
Number of successful extensions: 20892
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20890
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62558016040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -