SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11b12r
         (470 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    23   1.6  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    23   1.6  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   6.7  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   6.7  

>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -2

Query: 469 ISVNFVSRCARIVKFHSHQFLITRLKKYNFKK 374
           ++V+F+      VKF  H   + R +  NF+K
Sbjct: 376 LNVSFIDAAGSEVKFDEHGDGLARYEILNFRK 407


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -2

Query: 469 ISVNFVSRCARIVKFHSHQFLITRLKKYNFKK 374
           ++V+F+      VKF  H   + R +  NF+K
Sbjct: 466 LNVSFIDAAGSEVKFDEHGDGLARYEILNFRK 497


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 141 RLWFLCSLYVH 109
           R+WFL +L VH
Sbjct: 10  RVWFLSALVVH 20


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 141 RLWFLCSLYVH 109
           R+WFL +L VH
Sbjct: 10  RVWFLSALVVH 20


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,255
Number of Sequences: 438
Number of extensions: 2339
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12682287
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -