SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11b07r
         (763 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha...    27   2.2  
SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizos...    27   2.9  

>SPBC23E6.09 |ssn6||transcriptional corepressor
           Ssn6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1102

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 9/13 (69%), Positives = 12/13 (92%)
 Frame = +3

Query: 195 HVISNPPEPLTVL 233
           H++ NPP+PLTVL
Sbjct: 500 HILDNPPKPLTVL 512


>SPCC1020.10 |oca2||serine/threonine protein kinase Oca2
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 650

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%)
 Frame = +2

Query: 407 TSASVSNILRLDP---HELTYSFGDTGIDPLGYHHR*KKKLLHNCTKIFI*NCNAESP 571
           T A ++++L LDP   +++   F D  I+ +   H    K++H+ T +     + ESP
Sbjct: 587 TRAVIAHMLELDPVKRYDIHRVFADNWINDISMCHMENGKVIHSPTHVHNLVASEESP 644


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,859,729
Number of Sequences: 5004
Number of extensions: 54696
Number of successful extensions: 146
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 146
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 365309308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -