Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11a17r
         (343 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    21   4.6  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    20   8.1  

>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 20.6 bits (41), Expect = 4.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 15  IGGWSSSVEQYS 50
           IGGW+   E YS
Sbjct: 102 IGGWNEGSETYS 113


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 19.8 bits (39), Expect = 8.1
 Identities = 7/40 (17%), Positives = 22/40 (55%)
 Frame = +3

Query: 165 LISLVSVCNIVSFMLTTNCISDIMVRSLCVKQTNLQLNNV 284
           L +++  C+++SF++     +  +  ++ +K     +NN+
Sbjct: 168 LPNVILACHMLSFLMVHQGETQFVAANVILKTRFKTINNI 207


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 79,893
Number of Sequences: 336
Number of extensions: 1502
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  6664455
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)