Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11a15r
         (724 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   2.9  
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    21   8.9  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = -2

Query: 192 RLKRQETMKSQRVSTETDWTTPLWNQIPSDRFIVNSE 82
           RL+  E M S+    E DW   +W     D F  N++
Sbjct: 96  RLRLPENMTSEYRLLEVDWLKNMWR---PDSFFKNAK 129


>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 511 SLCRRLPYAFLRP 549
           S CR +P  FLRP
Sbjct: 640 SACRDIPEEFLRP 652


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,721
Number of Sequences: 438
Number of extensions: 3492
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22413960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)