SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner11a15f
         (624 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock p...    69   2e-13
AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding pr...    25   1.5  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            24   4.5  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            23   7.9  
AF437888-1|AAL84183.1|  154|Anopheles gambiae odorant binding pr...    23   7.9  
AF316638-1|AAG45166.1|  211|Anopheles gambiae glutathione S-tran...    23   7.9  

>AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock
           protein protein.
          Length = 133

 Score = 68.5 bits (160), Expect = 2e-13
 Identities = 28/72 (38%), Positives = 49/72 (68%)
 Frame = +2

Query: 251 DKLEVNMNVKRFSPDEIKVTVKNKYITVEGKHKEAGDIKKFLTNHFVQRFVLPPGSKQEE 430
           DK ++N++V++FSP+EI V   +  + VEGKH+E  D   +++ HFV+R++LP G  + +
Sbjct: 13  DKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEAD 72

Query: 431 VRAIYKENGILT 466
           + +    +GILT
Sbjct: 73  IVSSLSSDGILT 84


>AY146729-1|AAO12089.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP5 protein.
          Length = 156

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 511 SFWWWRWQFVF 479
           S WWWRW + F
Sbjct: 6   SCWWWRWWWDF 16


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 4/22 (18%)
 Frame = -3

Query: 544  GFWLYYF----DGN*SFWWWRW 491
            GF+LY      DGN  FW W W
Sbjct: 2838 GFFLYSGSMANDGNLRFWEWDW 2859


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 523  DGN*SFWWWRW 491
            DGN  FW W W
Sbjct: 2848 DGNARFWEWDW 2858


>AF437888-1|AAL84183.1|  154|Anopheles gambiae odorant binding
           protein protein.
          Length = 154

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 502 WWRWQFV 482
           WWRW F+
Sbjct: 9   WWRWDFI 15


>AF316638-1|AAG45166.1|  211|Anopheles gambiae glutathione
           S-transferase D12 protein.
          Length = 211

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -3

Query: 388 EMIRQELLYVAGFLMLSFDRDVFVFHCYFDLIR 290
           EM   +  YVAG  +   D  +FV  C  D+++
Sbjct: 136 EMYLTDSPYVAGQKLTIADFSIFVSFCSLDMMK 168


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 561,071
Number of Sequences: 2352
Number of extensions: 9533
Number of successful extensions: 16
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 60632475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -