BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o22f (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 24 0.98 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 24 0.98 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 0.98 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 0.98 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 1.3 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 3.0 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 3.0 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 3.0 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 3.0 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 4.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 5.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 5.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.3 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 6.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 6.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 6.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 6.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.2 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 9.2 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 34 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 83 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQ-ARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R+ R+R + +P Sbjct: 283 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSREHRIIP 332 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.8 bits (49), Expect = 1.3 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 221 TLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLAR-QARNRGNYYVP 367 T +RR S +++ + + E+ +EYR R+ R R + R+R + +P Sbjct: 282 TSRRRYSRSREREQKSYKNEREYREYRETSRERSRDRRGRGRSREHRIIP 331 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKER 313 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKER 313 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKER 313 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKER 313 RS + + RE K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 204 LGDYRLR*RGVLLPSRRRGKSS 269 + DY++ + +LLP R GKS+ Sbjct: 128 VADYKIEGKVLLLPVRGAGKSN 149 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 + RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKERD-EIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 227 KRRSSAIKKKREIFKRAEQYVKEYRIKER 313 + RS + + RE K+ QY K + KE+ Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 9.2 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 233 RSSAIKKKREIFKRAEQYVKEYRIKER-DEIRLARQARNR 349 RS + + RE K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 41 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 492 FRRTNTPLFIWRSLNSCRTLRTFG 421 F TP+FI+ S N+ L G Sbjct: 96 FMMIKTPIFIYNSFNTGFALGNLG 119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,173 Number of Sequences: 438 Number of extensions: 3010 Number of successful extensions: 42 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -