BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o19r (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 4.6 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 6.1 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 590 KKTFYTKSIYK*KIFLLWSSWLEYSAKVRNLLYGGCF 700 KK FY+K I IF+ +S+ NL G F Sbjct: 229 KKVFYSKIIISGSIFMTTTSFYRILNSGYNLTTFGSF 265 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 323 LLLQVEYLLVSNNLNQEFFFYFMRVRETYRICNGSL 216 LLL YL +S+ + F Y++ TY +CN ++ Sbjct: 127 LLLFDAYLWISS-VGVRMFQYYIGRSFTYYVCNTTI 161 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,006 Number of Sequences: 336 Number of extensions: 3587 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -