BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o19r (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0524 - 3794723-3795238,3796209-3796378,3797129-3797615 28 7.0 04_04_0008 + 22125707-22125828,22127122-22127197,22127297-221273... 28 7.0 >06_01_0524 - 3794723-3795238,3796209-3796378,3797129-3797615 Length = 390 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 152 WLVAFKLLMSMGSGYNSKLDEPTIPSTHHINK 57 W + F LL S + + S++DE S HH+N+ Sbjct: 202 WKIYFTLLESNLTEHTSEVDENVPGSVHHVNE 233 >04_04_0008 + 22125707-22125828,22127122-22127197,22127297-22127367, 22127502-22127995,22128079-22128239,22128329-22128532, 22129292-22129526,22129996-22130591 Length = 652 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -1 Query: 278 QEFFFYFMRVRETYR-ICNGSLNNNLKRNHGTVVLIIRTHVSRWLVA--FKLLMSMGSGY 108 +EF + ++ RE R + G L LK GT+ +I T S W+ + F+L + + SG+ Sbjct: 173 EEFENHIVKEREGKRPLLTGDLQVTLKEGVGTIGELIFTDNSSWIRSRKFRLGLRVSSGF 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,506,435 Number of Sequences: 37544 Number of extensions: 290963 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -