BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o19f (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 25 1.3 AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 24 3.1 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 23 7.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.2 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 9.5 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 356 TSAANSSALTVA*TSCSSDISTRSGFLSKRRS 261 T S LT+A SC S +++ GF+ RS Sbjct: 150 TDYVAGSRLTIADLSCISSVASMVGFIPMERS 181 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 338 SALTVA*TSCSSDISTRSGFLSKRRS 261 S +T+A SC S +++ GF+ RS Sbjct: 156 SRMTIADLSCISSVASMVGFIPMERS 181 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 23.0 bits (47), Expect = 7.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 311 CSSDISTRSGFLSKRRSITDDTIE 240 C S ISTR RRS+T + +E Sbjct: 27 CRSLISTRQHGFFPRRSVTTNLVE 50 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 241 SIVSSVILRRLDKKPD-RVEISEEQLVQATVRAEELAAEVGQP 366 S+ S +R + D + + E ++QA+ R ELA + G+P Sbjct: 2522 SVDDSETIREYRRPRDVLLSVVGEFIIQASTRLAELARKQGEP 2564 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 385 YHSHPHITVWPSHVDLATQSMY 450 YHSHPH T +L + Y Sbjct: 326 YHSHPHHTPVQFKTELHDNTQY 347 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,523 Number of Sequences: 2352 Number of extensions: 9460 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -