BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o18r (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac... 38 0.002 SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyc... 35 0.013 SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces po... 31 0.16 SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|c... 29 0.65 SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c... 29 0.86 SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Sch... 28 1.5 SPAC27D7.03c |mei2||RNA-binding protein involved in meiosis Mei2... 27 2.0 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 27 2.0 SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 26 4.6 SPBC1347.05c |||DNAJ domain protein Scj1|Schizosaccharomyces pom... 26 4.6 SPMIT.02 |||mitochondrial DNA binding endonuclease|Schizosacchar... 26 6.0 SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pomb... 26 6.0 SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 25 8.0 >SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosaccharomyces pombe|chr 2|||Manual Length = 290 Score = 37.5 bits (83), Expect = 0.002 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -3 Query: 645 ASEYNINSMPTFVFVKNGKKLDEFSGAN 562 AS + +MPTFVF +NGK++D +GAN Sbjct: 67 ASGLGVKAMPTFVFFENGKQIDMLTGAN 94 >SPAC7D4.07c |trx1||cytosolic thioredoxin Trx1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 34.7 bits (76), Expect = 0.013 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -3 Query: 645 ASEYNINSMPTFVFVKNGKKLDEFSGAN 562 A+E +++MP+F KNG+K++E GAN Sbjct: 64 AAEAGVHAMPSFFLYKNGEKIEEIVGAN 91 >SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces pombe|chr 1|||Manual Length = 492 Score = 31.1 bits (67), Expect = 0.16 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 642 SEYNINSMPTFVFVKNGKKLDEFSG 568 SEY+I PT KNGK++ ++SG Sbjct: 88 SEYSIRGYPTLNVFKNGKQISQYSG 112 >SPBC26H8.06 |grx4||glutaredoxin Grx4|Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 29.1 bits (62), Expect = 0.65 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 645 ASEYNINSMPTFVFVKNGKKLDEFSGAN 562 A +++N++P FV + K L SGAN Sbjct: 66 AESFDVNAVPLFVLIHGAKVLARISGAN 93 >SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 28.7 bits (61), Expect = 0.86 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 405 KFITDVKNIFYSFIKNVYMFFFFNSILVSI 494 KFI D +N F+ I Y F F ++L+ + Sbjct: 436 KFILDSQNFFFESINTEYSFIIFTNLLMHL 465 >SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 27.9 bits (59), Expect = 1.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 400 SSNSLQTLKTFFIHLLKTYTCFFFLIP 480 SS +L +F+ L++ + CFFF+ P Sbjct: 50 SSGPFISLSFWFLSLVRGFVCFFFMFP 76 >SPAC27D7.03c |mei2||RNA-binding protein involved in meiosis Mei2|Schizosaccharomyces pombe|chr 1|||Manual Length = 750 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 381 QTQKINIFKFITDVKNIFYSFIKNVYMFFFFNSILVSIGGC 503 ++ + N ++TD +NIF +F+ N + F + L I C Sbjct: 71 KSSESNSIDYLTDTQNIFPNFVNNENNYQFSTAPLNPIDAC 111 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 173 IGEIIHLSKPDKNKNKNITIHTLKFLSNHL 262 +G I HL K D+N K ++TL F+ N L Sbjct: 1251 LGFIHHLKKKDQNMEKVPVLYTLDFIWNTL 1280 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 26.2 bits (55), Expect = 4.6 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 360 FFAFQRLQTQKINIFKFITDVKNIFYSFIKNVYMFFFFNSILVSI 494 +F +++T K FI KNIF F +FF F IL SI Sbjct: 84 WFPRNKIRTAKYTPIDFIP--KNIFLQFQNVANLFFLFLVILQSI 126 >SPBC1347.05c |||DNAJ domain protein Scj1|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 137 KHDGNLSYTLISIGEIIHLSKPDKNKNKNITIHTL 241 K DG+ S GE++H + ++ KN+ + I+ L Sbjct: 301 KLDGSFMEVKRSAGEVVHPGETERVKNQGMPIYNL 335 >SPMIT.02 |||mitochondrial DNA binding endonuclease|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 384 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +3 Query: 342 ITTEPIFFAFQRLQTQKINIFKFITDVKNIFYSFIKNVYMFFFFNSILVSIGGCVQL*SL 521 + T+ I+F + T + + + +++ F S ++N+ FF S G C+ L Sbjct: 22 VITQLIYFLTSKKITN-LGKIRLVKSIRDSFLSQLENILCFFLVYRTTYSFGVCLMKRFL 80 Query: 522 F 524 F Sbjct: 81 F 81 >SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 25.8 bits (54), Expect = 6.0 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 125 KSF*KH---DGNLSYTLISIGEIIHLSKPDKNKNKNITIHTLKFLSNHLVKKTKI 280 KSF KH D L ++ S+ ++ KP KN N + HTL + L++ +K+ Sbjct: 223 KSFQKHKRLDEQLLNSVKSMKKVSQQLKPQKNTNDSNNDHTL-LSQDQLIELSKL 276 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 391 KLISSNSLQTLKTFFIHLLKTY 456 KL+SSN+LQ + F+ ++K + Sbjct: 412 KLVSSNTLQAMSHFYATMIKLF 433 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,694,208 Number of Sequences: 5004 Number of extensions: 54472 Number of successful extensions: 176 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -