BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o18f (483 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 71 3e-13 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 69 2e-12 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 68 4e-12 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 68 4e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 66 9e-12 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 64 5e-11 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 64 6e-11 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 64 6e-11 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 62 1e-10 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 62 3e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 3e-10 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 61 4e-10 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 61 4e-10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 3e-09 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 58 3e-09 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 54 4e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 53 9e-08 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 51 4e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 8e-07 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 49 2e-06 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 47 8e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 46 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 46 2e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 46 2e-05 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 45 3e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 3e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 44 7e-05 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 44 7e-05 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 43 9e-05 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 42 2e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 42 3e-04 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 41 5e-04 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 41 5e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 9e-04 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 9e-04 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.001 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 39 0.002 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 38 0.004 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 38 0.005 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 38 0.005 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 38 0.005 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 38 0.005 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 37 0.006 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 37 0.008 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 37 0.008 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.014 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.019 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.019 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.044 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.076 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.076 At3g03860.1 68416.m00398 expressed protein 33 0.13 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 33 0.13 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 33 0.13 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 33 0.13 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.23 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 1.6 At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase f... 28 2.9 At4g31240.2 68417.m04435 expressed protein 28 3.8 At4g31240.1 68417.m04434 expressed protein 28 3.8 At1g78740.1 68414.m09177 hypothetical protein 27 5.0 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 27 5.0 At2g29040.1 68415.m03530 exostosin family protein contains Pfam ... 27 6.6 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 71.3 bits (167), Expect = 3e-13 Identities = 32/91 (35%), Positives = 50/91 (54%) Frame = +2 Query: 113 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 292 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 293 XXXASEYNINSMPTFVFVKNGKKLDEFSGAN 385 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.9 bits (161), Expect = 2e-12 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%) Frame = +2 Query: 110 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 283 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVD 99 Query: 284 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 391 E+N++++P VF+K G+++D G VD Sbjct: 100 VLMSVW-MEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 67.7 bits (158), Expect = 4e-12 Identities = 31/94 (32%), Positives = 53/94 (56%) Frame = +2 Query: 104 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 283 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 284 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 385 AS +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAAS-WNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 67.7 bits (158), Expect = 4e-12 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = +2 Query: 146 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 325 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 326 MPTFVFVKNGKKLDEFSGA 382 +PTF+ K+GK D F GA Sbjct: 131 LPTFILFKDGKLWDRFEGA 149 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 66.5 bits (155), Expect = 9e-12 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 340 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 341 FVKNGKKLDEFSGANVD 391 VK GK+++ GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 64.1 bits (149), Expect = 5e-11 Identities = 33/92 (35%), Positives = 50/92 (54%) Frame = +2 Query: 110 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 289 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 290 XXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 385 +S ++I + PTF F+KNG+++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 63.7 bits (148), Expect = 6e-11 Identities = 32/96 (33%), Positives = 52/96 (54%) Frame = +2 Query: 104 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 283 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 284 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 391 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 68 DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 63.7 bits (148), Expect = 6e-11 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 340 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 341 FVKNGKKLDEFSGA 382 K+G+ D F GA Sbjct: 141 LFKDGEPCDRFEGA 154 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 62.5 bits (145), Expect = 1e-10 Identities = 30/90 (33%), Positives = 43/90 (47%) Frame = +2 Query: 122 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 301 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 302 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 391 A E I +PTF +K+ K + E +GA + Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 61.7 bits (143), Expect = 3e-10 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +2 Query: 152 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 331 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 332 TFVFVKNGKKLDEFSGANVD 391 FVFVK G+++D GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 61.3 bits (142), Expect = 3e-10 Identities = 31/85 (36%), Positives = 42/85 (49%) Frame = +2 Query: 137 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 316 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 317 INSMPTFVFVKNGKKLDEFSGANVD 391 + +MPTFVF+K G +D GA D Sbjct: 78 VEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 60.9 bits (141), Expect = 4e-10 Identities = 30/90 (33%), Positives = 49/90 (54%) Frame = +2 Query: 113 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 292 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 293 XXXASEYNINSMPTFVFVKNGKKLDEFSGA 382 A+ Y I S+PT + K G+K D GA Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 60.9 bits (141), Expect = 4e-10 Identities = 30/90 (33%), Positives = 42/90 (46%) Frame = +2 Query: 122 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 301 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 302 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 391 A E I +PTF +K+ K + E +GA D Sbjct: 134 AKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.0 bits (134), Expect = 3e-09 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 137 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 316 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 317 INSMPTFVFVKNGKKLDEFSGA 382 + +MPTF+F+K G+ + GA Sbjct: 78 VQAMPTFIFMKEGEIKETVVGA 99 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 58.0 bits (134), Expect = 3e-09 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = +2 Query: 125 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 304 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 305 SEYNINSMPTFVFVKNGKKLDEFSGA 382 +Y + S+PT + NG+K D GA Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 54.4 bits (125), Expect = 4e-08 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 VV+DF A WCGPCKMI P ++++A +Y + S+PT + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 350 NGKKLDEFSGA 382 G+K D GA Sbjct: 161 GGEKKDTIIGA 171 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 53.2 bits (122), Expect = 9e-08 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 V+++F +WCGPC+M+ +DEIA + A EY I ++P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 350 NGKKLDEFSG 379 NG+K + G Sbjct: 147 NGEKRESIMG 156 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 51.2 bits (117), Expect = 4e-07 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 350 NGKKL 364 +GK++ Sbjct: 150 DGKEV 154 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 8e-07 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +2 Query: 98 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 247 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 3/101 (2%) Frame = +2 Query: 92 YLPKMSIH-IKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 262 Y K +H + + + ++ EA K++V++F A+WC P K I P E+A+ Sbjct: 36 YFIKGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSM 94 Query: 263 XXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 385 + E+N+++ PT VF+K+G+++D+ G + Sbjct: 95 IFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 46.8 bits (106), Expect = 8e-06 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = +2 Query: 116 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 289 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 290 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 388 S+ NI ++PT F K G K E GA+V Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +2 Query: 116 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 295 + DL L AGDKLVV+DF + CG CK + PK+ +I AE Sbjct: 98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQVNYEEHR 156 Query: 296 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 385 NI+ +P F F + ++ FS N Sbjct: 157 SLCQSLNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 98 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 277 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 278 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 376 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 98 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 277 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 278 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 376 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 44.8 bits (101), Expect = 3e-05 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +2 Query: 116 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 289 +K + + L++A D + V F A WCGPC++I P + E++ + Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEG 113 Query: 290 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 388 A + N++++PT F K G K E G +V Sbjct: 114 GLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 44.8 bits (101), Expect = 3e-05 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +2 Query: 116 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 295 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 296 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 385 ++ +P F F + + ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.6 bits (98), Expect = 7e-05 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +2 Query: 110 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 289 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++ AE Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQL-AETNPNVMFLKVNQEE 146 Query: 290 XXXXASEYNINSMPTFVFVKNGK-KLDEFS 376 N++ +P F F + + K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 43.6 bits (98), Expect = 7e-05 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +2 Query: 188 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLD 367 A WC PCK I P ++A+ ++E+N+ + PT VF+K+G+++D Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEF-SNEWNVEATPTVVFLKDGRQMD 75 Query: 368 EFSGA 382 + GA Sbjct: 76 KLVGA 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 43.2 bits (97), Expect = 9e-05 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 158 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 331 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 332 TFVFV 346 T F+ Sbjct: 151 TLFFI 155 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 +V F A WC P + +E+A AS+ + +MPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEV-ASQLEVKAMPTFLFLK 85 Query: 350 NGKKLDEFSGANVD 391 +G +D+ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 334 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 335 FVFVKN-GKKLDEFSG 379 ++N GK + +++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 38.7 bits (86), Expect = 0.002 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Frame = +2 Query: 83 VSIYLPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 241 V+++ I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 357 VAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 40.7 bits (91), Expect = 5e-04 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +2 Query: 167 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 346 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 347 KNGKKLDEFSGA 382 GK ++ GA Sbjct: 110 VPGKAPIDYQGA 121 Score = 33.5 bits (73), Expect = 0.076 Identities = 13/60 (21%), Positives = 24/60 (40%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 340 ++L +++F A WCG CK + P+ A + S + + PT + Sbjct: 180 NELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTIL 239 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 40.7 bits (91), Expect = 5e-04 Identities = 18/72 (25%), Positives = 37/72 (51%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 V++ F A WCGPC+ + P L+++ +E ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 350 NGKKLDEFSGAN 385 G+++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.9 bits (89), Expect = 9e-04 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 334 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 335 F-VFVKNGKKLDEFSG 379 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 125 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 241 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.9 bits (89), Expect = 9e-04 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 334 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 335 F-VFVKNGKKLDEFSG 379 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 125 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 241 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = +2 Query: 167 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 346 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 347 KNGKKLDEFSGA 382 GK ++ GA Sbjct: 108 VPGKPPIDYQGA 119 Score = 35.5 bits (78), Expect = 0.019 Identities = 21/89 (23%), Positives = 35/89 (39%), Gaps = 2/89 (2%) Frame = +2 Query: 98 PKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXX 271 P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 162 PSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLG 217 Query: 272 XXXXXXXXXXASEYNINSMPTFVFVKNGK 358 S + + PT + + K Sbjct: 218 HVNCDAEQSIKSRFKVQGFPTILVFGSDK 246 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 340 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 341 FVKNGKKLDEFSGANVD 391 +G ++ + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 346 VVI +MA WC C + PKL+++AAE S + MPT Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 347 KNGKKLDEFSGAN 385 ++G+K E G + Sbjct: 161 RDGQKQAEVIGGH 173 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 337 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 338 VFVKNGK 358 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.54 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 343 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 344 VKNGKKLDE 370 G K E Sbjct: 520 FPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 337 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 338 VFVKNGK 358 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.54 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 343 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 344 VKNGKKLDE 370 G K E Sbjct: 520 FPAGNKTSE 528 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 346 ++I++MA+WC C + PKL+++AAE NI+ MPT Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQLW 180 Query: 347 KNGKKLDEFSGAN 385 K + +E G + Sbjct: 181 KEDEMKEEVIGGH 193 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +2 Query: 170 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 349 VV+ F A+WC K + +A + + Y++ ++P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEI-SEAYSVAAVPYFVFFK 82 Query: 350 NGKKLDEFSGAN 385 +GK +D GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 37.1 bits (82), Expect = 0.006 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +2 Query: 158 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 328 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 329 PTFVFVKNGKKLDEFSGA 382 PTF+F+++G+ + G+ Sbjct: 266 PTFLFIRDGEIRGRYVGS 283 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 36.7 bits (81), Expect = 0.008 Identities = 16/73 (21%), Positives = 28/73 (38%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 340 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 341 FVKNGKKLDEFSG 379 +G+ + G Sbjct: 176 LFVDGEMRKTYEG 188 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/76 (19%), Positives = 27/76 (35%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 343 K V+++ A WCG C+ P +++ + + PT +F Sbjct: 456 KDVLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTILF 515 Query: 344 VKNGKKLDEFSGANVD 391 G K + +VD Sbjct: 516 FPGGNKSFDPIAVDVD 531 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 36.7 bits (81), Expect = 0.008 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +2 Query: 128 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXAS 307 DD+K+ + A VI++ A+WCG C I P +++ + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFSKLKFVYADIDECPE---T 88 Query: 308 EYNINSMPTFVFVKNGKKLDEFSGA 382 +I PTF F ++G+K+DE GA Sbjct: 89 TRHIRYTPTFQFYRDGEKVDEMFGA 113 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.9 bits (79), Expect = 0.014 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +2 Query: 104 MSIHIKD--SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 277 MS +KD S + L +G LV + F A+WC K + +A + Sbjct: 1 MSGTVKDIVSKEELDNLRHSGAPLV-LHFWASWCDASKQMDQVFSHLATDFPRAHFFRVE 59 Query: 278 XXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 385 + Y++ +P FVF K+GK +D GA+ Sbjct: 60 AEEHPEI-SEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 35.5 bits (78), Expect = 0.019 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 334 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 335 F-VFVKNGKKLDEFSG 379 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.033 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAA 244 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 35.5 bits (78), Expect = 0.019 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 334 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 335 F-VFVKNGKKLDEFSG 379 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.033 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 161 DKLVVIDFMATWCGPCKMIGPKLDEIAA 244 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.044 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 113 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 238 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.13 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 250 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.5 bits (73), Expect = 0.076 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 119 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 271 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 163 Query: 272 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 376 A I ++P F F KNG L+ F+ Sbjct: 164 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.5 bits (73), Expect = 0.076 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 119 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 271 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 150 Query: 272 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 376 A I ++P F F KNG L+ F+ Sbjct: 151 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 32.7 bits (71), Expect = 0.13 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 1/106 (0%) Frame = +2 Query: 32 CHLRVSYLHFKL*YYFLVSIYLPKMSIHIKDSDDLKTRLA-EAGDKLVVIDFMATWCGPC 208 C+ F L S+Y P I + D D L +A + G+ + + F A+WC Sbjct: 32 CNYEFELFRFDLEAKCPPSLY-PTPPIEV-DGDSLDRLMASQHGNAYMSVLFYASWCPFS 89 Query: 209 KMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 346 + + PK D +++ S Y I+S+P+ + V Sbjct: 90 RAVRPKFDMLSSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSILMV 135 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.13 Identities = 21/101 (20%), Positives = 40/101 (39%), Gaps = 2/101 (1%) Frame = +2 Query: 83 VSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 262 + I L K + + ++ E D + F WC CK +G +++ M Sbjct: 18 IPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCKKLGNLWEDLGKAMEGDD 76 Query: 263 XXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 379 A ++ I+S PTF+ NG+++ ++ G Sbjct: 77 EIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.13 Identities = 21/101 (20%), Positives = 40/101 (39%), Gaps = 2/101 (1%) Frame = +2 Query: 83 VSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 262 + I L K + + ++ E D + F WC CK +G +++ M Sbjct: 18 IPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCKKLGNLWEDLGKAMEGDD 76 Query: 263 XXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 379 A ++ I+S PTF+ NG+++ ++ G Sbjct: 77 EIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.13 Identities = 21/101 (20%), Positives = 40/101 (39%), Gaps = 2/101 (1%) Frame = +2 Query: 83 VSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 262 + I L K + + ++ E D + F WC CK +G +++ M Sbjct: 18 IPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCKKLGNLWEDLGKAMEGDD 76 Query: 263 XXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 379 A ++ I+S PTF+ NG+++ ++ G Sbjct: 77 EIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.23 Identities = 17/82 (20%), Positives = 32/82 (39%) Frame = +2 Query: 143 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNIN 322 +L +++++ + + CGPC+ + P L+++ E A I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 323 SMPTFVFVKNGKKLDEFSGANV 388 P F KN + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 1.6 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 119 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 217 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase family protein contains Pfam PF01553: Acyltransferase Length = 376 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/52 (23%), Positives = 29/52 (55%) Frame = +2 Query: 71 YYFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPK 226 + +S+++P ++ +K D L+ ++ +++ F+A+W G K GP+ Sbjct: 108 WIIFLSLFIPVNAL-LKGQDRLRKKIERVLVEMICSFFVASWTGVVKYHGPR 158 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKL 229 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 164 KLVVIDFMATWCGPCKMIGPKL 229 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 5.0 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 429 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 328 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.5 bits (58), Expect = 5.0 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +2 Query: 158 GDKLVVIDFMATWCGPCKMIGPKLDEIAA---EMXXXXXXXXXXXXXXXXXASEYNINSM 328 G++ V++ A WC + P+ E A E+ ASE I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 329 PTFVFVKNGKKLDEFSGANVD 391 PT + NG L G++ + Sbjct: 153 PTLLLFVNGTSLTYNGGSSAE 173 >At2g29040.1 68415.m03530 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 720 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 67 VILFFSFNLSAQDVHSHQRFRRPED 141 ++L + F+ SA+ VH+H+R R E+ Sbjct: 26 LVLLYLFSSSAKTVHNHERLFRQEN 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,136,398 Number of Sequences: 28952 Number of extensions: 157563 Number of successful extensions: 524 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -