BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o16r (753 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 31 0.23 SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 29 0.71 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 29 0.71 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 28 1.6 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 2.2 SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ... 27 3.8 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 3.8 SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces p... 26 6.6 SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe... 25 8.8 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 30.7 bits (66), Expect = 0.23 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -3 Query: 727 VVADYDSAVE--KSKH--LYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKD 569 V D +S E K KH + + +KS + ++ K+++ NK+N +E A Q W + K+ Sbjct: 119 VEGDENSYAETPKKKHSLIRKRRKSPLDSSSAQKVLKKNKLNTLEQAQQNWSKYIKE 175 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 29.1 bits (62), Expect = 0.71 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 403 VSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNG 293 + +K I L++NN+ KILN R V+ VGT NG Sbjct: 254 IFFKCIPLFKNNEEAEKILNVNRLLDRVMFVGTKVNG 290 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 29.1 bits (62), Expect = 0.71 Identities = 27/107 (25%), Positives = 50/107 (46%) Frame = -1 Query: 747 SSFTIASSLPITTVRLKRASIYTRRRRAKSSQM**TN*YETTR*TAWSTPINFGSRAPRT 568 S++TI+SS P+T+ + + T +S + TT T ST + + S + Sbjct: 512 SNYTISSSTPVTSTPVTTTNCTTSTSVLYTSTPVTSTPLATTNCTT-STSVPYTSTPVTS 570 Query: 567 SSVIVSQLSSDLSSPKTPLSLCTSATVSL*R*VMMFTATMADLPSAT 427 S+ +S + S+P T + TS +V ++T+T P++T Sbjct: 571 SNYTISSSTPVTSTPVTTTNCTTSTSV-------LYTSTPITSPNST 610 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 27.9 bits (59), Expect = 1.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 418 KTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTN 302 K SPKV+WK +W + K K +++ +LG G++ Sbjct: 28 KASPKVNWKTHIIWRSLK-NVKCIDSFHGNNEILGAGSS 65 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 745 QLYNSIVVADYDSAVEKSKHLYEEKKS 665 QL N DY+ E++K LY+E+KS Sbjct: 184 QLQNENFKDDYEKIKEENKRLYKERKS 210 >SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 673 KKSEVITNVVNKLIRNNKMNCMEYAYQLWLQ 581 K+ +T+ NKL+ ++ + +YAY L LQ Sbjct: 35 KREAQLTDTPNKLLTDHDQSASDYAYALKLQ 65 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 26.6 bits (56), Expect = 3.8 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 585 SRAPRTSSVIVSQLSSDLSSP-KTPLSLCTSATVS 484 S P T S + S LSS SSP T LS+ +S+T S Sbjct: 567 SSIPSTFSSVSSILSSSTSSPSSTSLSISSSSTSS 601 >SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 926 Score = 25.8 bits (54), Expect = 6.6 Identities = 25/91 (27%), Positives = 39/91 (42%) Frame = -3 Query: 352 ILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKA 173 +++T +Q+L +G P AFGVNS+ +A + P DN N + Sbjct: 813 LVDTHIHQFLYIGKDAVPQLLIDAFGVNSLADLKAGRFTMPV---IDNPL---NVRINAI 866 Query: 172 LTLSRTLETSGNRMAWGYNGRVIGSPEHYAW 80 L R+L+ M Y R G P+ +W Sbjct: 867 LGKLRSLDKGSTIMPSLYLVRGDGDPQLRSW 897 >SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 182 Score = 25.4 bits (53), Expect = 8.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 320 YQILVTLSVQDLEVDLVVLPQSNELPADF 406 +Q+ V ++QDL+ L PQ N L +F Sbjct: 3 FQVRVKQNMQDLDNRLAAFPQLNSLEKNF 31 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,877,075 Number of Sequences: 5004 Number of extensions: 57551 Number of successful extensions: 184 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -