BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o16f (623 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 7.4 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 7.4 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 7.4 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.8 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 104 VPNDILEEQLYNSIVVADYDSAVEK 178 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 104 VPNDILEEQLYNSIVVADYDSAVEK 178 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 509 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 604 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 509 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 604 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 509 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 604 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 518 KILNTERNQYLVLGVGTNPN 577 ++ NT+RN+YL+ N N Sbjct: 366 RVNNTQRNEYLLALSDRNQN 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,227 Number of Sequences: 438 Number of extensions: 3024 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -