BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o10r (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.6 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 7.9 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 497 DYFGAHTYELLHNPGQFIHTNWT 429 DY + L + P Q+IH WT Sbjct: 440 DYIRKYLPVLKNMPSQYIHEPWT 462 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.4 bits (43), Expect = 7.9 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = -2 Query: 460 IPVSSFTRTGPGMAGKFPHRHTTTERNIIMINIIYCNFVLGETLKTIFEFYFCS 299 IP+ F G + H++TT NI + N++ +L + + E CS Sbjct: 6 IPLYLFLFVHYGWSEDTTHKYTTKYDNIDLENVVKNERLLKSYVDCLLEKGRCS 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,411 Number of Sequences: 336 Number of extensions: 3093 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -