BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o09r (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 24 1.3 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 24 1.8 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 24 1.8 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 4.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 4.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.4 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 362 HNDWSSEAWSRFPITR--YNKVQYPDFCLFNGYD 457 H W++ ++ + R YN+V PD L+N D Sbjct: 66 HLKWNASEFAGIRVIRVPYNRVWRPDTILYNNAD 99 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 76 NNTFFNDSIENRGRLYM*FYKKMFDNNHYL*QI 174 NN +N++ N +LY YKK++ N +Y+ QI Sbjct: 87 NNYNYNNN--NYKKLYCNNYKKLYYNINYIEQI 117 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 76 NNTFFNDSIENRGRLYM*FYKKMFDNNHYL*QI 174 NN +N++ N +LY YKK++ N +Y+ QI Sbjct: 87 NNYNYNNN--NYKKLYCNNYKKLYYNINYIEQI 117 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 76 NNTFFNDSIENRGRLYM*FYKKMFDNNHYL*QI 174 NN +N++ N +LY Y+K++ N +Y+ QI Sbjct: 87 NNYNYNNN--NYKKLYCNNYRKLYYNINYIEQI 117 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 392 RFPITRYNKVQYPDFCLFNGY 454 RF + YP+FC F Y Sbjct: 605 RFAVFALGSSAYPNFCAFGRY 625 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 420 YNILIFVYSTVMISENGSIYQNYQIIKYY-FVIITT 524 YN L+ + STV + I +N+ K+ F + TT Sbjct: 680 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTT 715 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 420 YNILIFVYSTVMISENGSIYQNYQIIKYY-FVIITT 524 YN L+ + STV + I +N+ K+ F + TT Sbjct: 770 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTT 805 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,856 Number of Sequences: 438 Number of extensions: 5428 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -