BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o08r (350 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07777.1 68415.m00893 expressed protein 30 0.38 At3g28180.1 68416.m03521 glycosyl transferase family 2 protein s... 29 1.2 At1g73090.1 68414.m08451 expressed protein 28 1.5 At3g21510.1 68416.m02714 two-component phosphorelay mediator 3 (... 28 2.0 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 27 2.7 At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1... 27 2.7 At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ... 27 2.7 At5g58720.1 68418.m07356 PRLI-interacting factor, putative simil... 27 3.5 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 27 3.5 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 27 4.6 At4g30010.1 68417.m04270 expressed protein 26 6.1 At4g04885.1 68417.m00711 pre-mRNA cleavage complex-related conta... 26 6.1 At3g62820.1 68416.m07058 invertase/pectin methylesterase inhibit... 26 6.1 At5g42880.1 68418.m05226 hypothetical protein contains Pfam prof... 26 8.1 At5g03350.1 68418.m00288 legume lectin family protein contains P... 26 8.1 At2g45400.1 68415.m05646 dihydroflavonol 4-reductase family / di... 26 8.1 At2g03160.1 68415.m00269 E3 ubiquitin ligase SCF complex subunit... 26 8.1 >At2g07777.1 68415.m00893 expressed protein Length = 262 Score = 30.3 bits (65), Expect = 0.38 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +3 Query: 99 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLA 263 LS+ V FF G+++ S F+L ++ S +FR L R+T C LA Sbjct: 11 LSSSVAGFFGRFLGSESVSRFNLIIFLILLVFSICLFRSLKQYLGKRMTQWCYLA 65 >At3g28180.1 68416.m03521 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 673 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = -2 Query: 232 APKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNL 74 A KE+ +ES + + +L+E+ + + ETVKK+ G ++ N+ N+ Sbjct: 570 AEKEEKLHRRNSESGLELLSKLKEQETNLVGQETVKKSLGGLMRPKNKKKTNM 622 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 28.3 bits (60), Expect = 1.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 146 LGPGDC*EKLWHDGRQLQRI 87 +GPG C + W +GR+LQ++ Sbjct: 272 IGPGVCVGQAWQEGRELQQV 291 >At3g21510.1 68416.m02714 two-component phosphorelay mediator 3 (HP3) identical to ATHP3 [Arabidopsis thaliana] GI:4156245 Length = 154 Score = 27.9 bits (59), Expect = 2.0 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 99 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFA-LSASVFRLL---SSLGASRLTNACTLAR 266 +S +V FF D + SL+ +V F + V +L SS+GA R+ NAC + R Sbjct: 42 VSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFR 101 Query: 267 QIANK 281 + Sbjct: 102 SFCEQ 106 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 256 VHAFVKRDAPKEDNSLNTLAESAKKTIEELREKVESA 146 VH KRD+ + L ESA++ ++EL + + S+ Sbjct: 563 VHEAHKRDSSSQVKELEARVESAEEQVKELNQNLNSS 599 >At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1 family protein similar to 13S condensin XCAP-D2 subunit [Xenopus laevis] GI:3764087; contains Pfam profile PF04594: Non-SMC condensin subunit, XCAP-D2/Cnd1 Length = 1439 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 214 SLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYK 80 SL T E K + E + E ALA + V +NF ++++ +F K Sbjct: 1171 SLLTFTEKGIKKLIESFKSYEHALAEDLVTENFRSIINKGKKFAK 1215 >At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ribosomal protein L24, Arabidopsis thaliana, EMBL:AC006282 Length = 163 Score = 27.5 bits (58), Expect = 2.7 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 238 RDAPKEDNSLNTLAESAKKTIEELR-EKVESALAPETVKKNF 116 RDA +E +L + E KKT +E + +KVE A + VK NF Sbjct: 104 RDAAREA-ALREIKERIKKTKDEKKAKKVEFASKQQKVKANF 144 >At5g58720.1 68418.m07356 PRLI-interacting factor, putative similar to PRLI-interacting factor N [Arabidopsis thaliana] GI:11139276; contains Pfam profile PF01713: Smr domain Length = 519 Score = 27.1 bits (57), Expect = 3.5 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = -2 Query: 241 KRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNLKPAE 62 KR + + T ++ KK +EE R+ E E V KNF ++S E + ++ E Sbjct: 12 KRSCAAKPSGDGTTSDGNKKDVEEERKDGEGKREIENVGKNF---IESLMEAFCSVSMEE 68 Query: 61 APKA 50 A A Sbjct: 69 AMAA 72 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 129 TVSGAKADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNAC 254 T G + S+FSL+S+ F + + LLS+ G + C Sbjct: 105 TALGYQLGSSFSLSSNNKFTLVGCNALSLLSTFGKQNYSTGC 146 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 26.6 bits (56), Expect = 4.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 285 LSCWLSASPMCMHSSNEMLLKK 220 L CW+ + CMHS E+L K+ Sbjct: 603 LRCWMYLAADCMHSITELLGKE 624 >At4g30010.1 68417.m04270 expressed protein Length = 90 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 199 AESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFY 83 +E K + EL ++S + ETVK + +D++NE Y Sbjct: 8 SEIRGKKVTELPGYIKSTFSMETVKTSVKRGLDNYNEKY 46 >At4g04885.1 68417.m00711 pre-mRNA cleavage complex-related contains weak similarity to Pre-mRNA cleavage complex II protein Pcf11 (Fragment) (Swiss-Prot:O94913) [Homo sapiens] Length = 808 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 308 IQNEQAADYLVGYLPRQC-ACIRQTRC 231 I+NE A L G LPRQC C + +C Sbjct: 636 IRNESAISALYGDLPRQCTTCGLRFKC 662 >At3g62820.1 68416.m07058 invertase/pectin methylesterase inhibitor family protein low similarity to pectinesterase from Arabidopsis thaliana SP|Q43867, Lycopersicon esculentum SP|Q43143; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 194 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 144 KADSTFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLAR 266 K + S+ ++VFF LS + L S S + NAC++ R Sbjct: 2 KTPMSSSITFALVFFLLSLNPTSSLPSKRESYVQNACSVTR 42 >At5g42880.1 68418.m05226 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 751 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 223 EDNSLNTLAESAKKTIEELREKVESA 146 E N ++ ESA++ +EE++ +E A Sbjct: 410 EKNDIHAAVESARRELEEVKANIEKA 435 >At5g03350.1 68418.m00288 legume lectin family protein contains Pfam domain, PF00139: Legume lectins beta domain Length = 274 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 196 ESAKKTIEELREKVESALAPETVKK 122 E K IE KV LAPETVKK Sbjct: 201 ERYKAWIEYRNSKVTVTLAPETVKK 225 >At2g45400.1 68415.m05646 dihydroflavonol 4-reductase family / dihydrokaempferol 4-reductase family similar to dihydroflavonol 4-reductase (SP:P51102), vestitone reductase (Medicago sativa, GI:973249) Length = 364 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 229 PKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGT 110 P + NS T K+T++ L ++S L +TVK+ F T Sbjct: 121 PMDPNSNETEETVTKRTVQGLMGILKSCLDAKTVKRFFYT 160 >At2g03160.1 68415.m00269 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At19), putative E3 ubiquitin ligase; similar to Skp1 GI:4959710 from [Medicago sativa] Length = 200 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 247 FVKRDAPKEDNSLNTLAESAK--KTIEELREKVESALAPETVK 125 + K+ +D+ + T S K KT+EE ++K + PE+ + Sbjct: 58 YCKKHVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTE 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,124,362 Number of Sequences: 28952 Number of extensions: 130036 Number of successful extensions: 430 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -