BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o07f (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 25 0.40 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.70 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 8.6 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 25.4 bits (53), Expect = 0.40 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 164 LPELSSDLVAALTSLDMYDFPHFVLFM*TINY--LTLKXCSARSTH 33 L E + +L AL+S++ F HFVL M IN+ +T AR H Sbjct: 870 LVEFALELKKALSSINEQSFNHFVLKM-GINHGPVTAGVIGARKPH 914 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.6 bits (51), Expect = 0.70 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 435 VDSVLDVVRKEAESCDCLQG 494 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 395 VAGAGLSEDEVVRTEDLSERSRADR-VHGAGLQVDED 288 ++ AG +++ R +RS +R VH G Q D D Sbjct: 1403 ISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQEDRD 1439 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 491 GIPTDTLARRRHRFRYGHP 547 GIP+ TL +R HR P Sbjct: 438 GIPSTTLWQRAHRLGIDTP 456 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,914 Number of Sequences: 438 Number of extensions: 2692 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -