BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o06r (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces po... 26 6.5 SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosa... 25 8.6 >SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces pombe|chr 3|||Manual Length = 742 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 438 LCIDGHPRVLYCGGESAFDDLTSTCVSADEVGACPA 331 LC+D H R+++ ++ DL + V A+ A A Sbjct: 224 LCVDQHGRIVFDSSDTVIKDLENKDVEAESQEAVVA 259 >SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = -3 Query: 464 LTTIARSISCASMGILASSIAVVSPHSTI*PQHVSPPMK*EHVLLS*GPQQSVPRTTQS 288 L+T SI+C+ + A V S + VSPPM E V S +S+P S Sbjct: 281 LSTACGSIACSMLTKTTPHRASVDILSNLHESTVSPPMADESVQRSSEVSKSIPNVELS 339 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,830,848 Number of Sequences: 5004 Number of extensions: 55674 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -