BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o06r (745 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0785 + 23135764-23135973,23136061-23136713,23136822-231369... 31 1.3 02_01_0714 + 5339408-5340020,5340117-5340319,5340408-5340605,534... 29 2.9 11_06_0186 + 21027581-21028825 29 3.9 04_03_0653 - 18429736-18431379 29 3.9 01_03_0127 + 12787664-12787907,12790660-12790715,12792203-127924... 29 3.9 06_03_0746 - 24111579-24112348,24113164-24113256,24113355-241134... 28 6.8 >12_02_0785 + 23135764-23135973,23136061-23136713,23136822-23136903, 23137031-23137113,23137229-23137361,23137493-23137664, 23137929-23138656 Length = 686 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 592 LRIESQSVGTYKIVAYTVHAVSESAAIAGVA*FEVSELMGTQFCR 726 L+ + Q+ G + AY HA+S+ I G+ F M FCR Sbjct: 545 LQYQQQTDGFEESYAYLEHAISQMGNIDGILGFSQGAAMAALFCR 589 >02_01_0714 + 5339408-5340020,5340117-5340319,5340408-5340605, 5340703-5340774,5341197-5341292,5341828-5341907, 5341993-5342068,5342152-5342362,5342562-5342755, 5342834-5342939,5343037-5343126,5343470-5344206 Length = 891 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 472 VSISGWGTKFSTYWYFGATESEESFSIAVGDFI 570 VS GWGTK+ ++W T ESFS +GD I Sbjct: 498 VSYHGWGTKYDSFWCCYGT-GIESFS-KLGDSI 528 >11_06_0186 + 21027581-21028825 Length = 414 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Frame = +1 Query: 424 PIDAQEILLAIV-----VRPVVSISGWGTKFSTYWYFGATESEESFSIAVGDFIRPF 579 PI ++I LA V V+P+ SG K+ WY G +S SI D +R F Sbjct: 110 PITGKQIALAPVTTIEQVKPIFDDSGAVHKYKYSWYTGQMTVSDSPSILAPDELRNF 166 >04_03_0653 - 18429736-18431379 Length = 547 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 168 RNSLISNHFNVPSARLNFYSLMTVFVLADTH 260 R+ +SN F P + L Y+ +T VL DTH Sbjct: 207 RSLAVSNCFLPPPSELRHYAALTKLVLQDTH 237 >01_03_0127 + 12787664-12787907,12790660-12790715,12792203-12792473, 12792600-12792832 Length = 267 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 732 PQPTELCPHQFGYFKLGDARNCSGFRNCVNGVGYDFVCPDGLAF 601 P P+ C + F GD+ +G G+GY F P+G AF Sbjct: 22 PSPSASCARRPVVFAFGDSNTDTG--GIAAGMGYYFPLPEGRAF 63 >06_03_0746 - 24111579-24112348,24113164-24113256,24113355-24113460, 24113587-24113783,24113893-24114103,24114198-24114273, 24114347-24114426,24114659-24114754,24114894-24114965, 24115067-24115264,24115273-24115569 Length = 731 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 472 VSISGWGTKFSTYWYFGATESEESFSIAVGDFI 570 VS GWGT+++++W T ESFS +GD I Sbjct: 325 VSYHGWGTQYNSFWCCYGT-GIESFS-KLGDSI 355 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,877,059 Number of Sequences: 37544 Number of extensions: 385390 Number of successful extensions: 842 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -