BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o05r (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 30 0.045 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 29 0.10 EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 25 1.7 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 25 1.7 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 3.9 AY118045-1|AAM54226.1| 69|Anopheles gambiae xanthine dehydroge... 23 3.9 AY118043-1|AAM54224.1| 69|Anopheles gambiae xanthine dehydroge... 23 3.9 AY118044-1|AAM54225.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118042-1|AAM54223.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118041-1|AAM54222.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118040-1|AAM54221.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118039-1|AAM54220.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118038-1|AAM54219.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118037-1|AAM54218.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118036-1|AAM54217.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118035-1|AAM54216.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AY118034-1|AAM54215.1| 69|Anopheles gambiae xanthine dehydroge... 23 5.1 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.1 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 6.8 AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding pr... 23 6.8 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 22 9.0 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 22 9.0 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 29.9 bits (64), Expect = 0.045 Identities = 13/56 (23%), Positives = 28/56 (50%) Frame = -1 Query: 306 LVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLG 139 L G++ K +++++A L ++A + D + ALC + +P + +LG Sbjct: 142 LRQGINSVVKMVEQKKAQLVIIAHDVDPIELVVYLPALCRKMGVPYCIIKGKARLG 197 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 28.7 bits (61), Expect = 0.10 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 321 LIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIP 172 LI+ G L E KA+++ Q V C+ A + + LC E+Q+P Sbjct: 34 LINLGKGEHLTEEFKAINRFQKVPCITDSQIKLAESVAIFRYLCREYQVP 83 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 135 WAGLCKIDKDGKARKIVGCS 76 WA CK+D+ G+ I G S Sbjct: 70 WADCCKVDEPGRVPHIGGLS 89 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 3.9 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 87 QFSLPCHPCQSCRDQPILQAFCCC 158 Q S + C S + P FCCC Sbjct: 123 QESCSSNECVSTTETPTRHFFCCC 146 >AY118045-1|AAM54226.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.4 bits (48), Expect = 3.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLMYLREKLRLCGTKLGCAEG 58 >AY118043-1|AAM54224.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.4 bits (48), Expect = 3.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLMYLREKLRLCGTKLGCAEG 58 >AY118044-1|AAM54225.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118042-1|AAM54223.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118041-1|AAM54222.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118040-1|AAM54221.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118039-1|AAM54220.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118038-1|AAM54219.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118037-1|AAM54218.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118036-1|AAM54217.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118035-1|AAM54216.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AY118034-1|AAM54215.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 23.0 bits (47), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 88 CRLLLCCHQRFRRGNSSVGCAQG 20 C LL+ ++ R + +GCA+G Sbjct: 36 CTLLVYLREKLRLCGTKLGCAEG 58 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 351 HSRPCCYPTRWGWWGPRLQHQP 416 HS Y GW+ QHQP Sbjct: 15 HSGNLPYSATTGWYPSNYQHQP 36 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 22.6 bits (46), Expect = 6.8 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -1 Query: 306 LVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIP 172 LVH EAA L + VL L AA KL + H +P Sbjct: 247 LVHAFCEAAPMLLLQLYVLVTLQSEAQLAAALKLKTLGHHHHHLP 291 >AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding protein AgamOBP28 protein. Length = 134 Score = 22.6 bits (46), Expect = 6.8 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = +3 Query: 135 ILQAFCCCQP*PVESDVRCTEPEQVSCMRLHHSSQPKHIVLL 260 +L A C + ++ E + C+ H +H+VLL Sbjct: 8 VLLAVCAAAQPLTDDQMKKAEGFALGCLEQHKGLNKEHLVLL 49 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 308 PPWIKAVF 331 PPWIK+VF Sbjct: 329 PPWIKSVF 336 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 308 PPWIKAVF 331 PPWIK+VF Sbjct: 329 PPWIKSVF 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,809 Number of Sequences: 2352 Number of extensions: 10159 Number of successful extensions: 44 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -