BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o05r (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32060.3 68415.m03918 40S ribosomal protein S12 (RPS12C) 157 3e-39 At2g32060.2 68415.m03917 40S ribosomal protein S12 (RPS12C) 157 3e-39 At2g32060.1 68415.m03916 40S ribosomal protein S12 (RPS12C) 157 3e-39 At1g15930.2 68414.m01912 40S ribosomal protein S12 (RPS12A) simi... 149 7e-37 At1g15930.1 68414.m01911 40S ribosomal protein S12 (RPS12A) simi... 149 7e-37 At5g08180.1 68418.m00955 ribosomal protein L7Ae/L30e/S12e/Gadd45... 32 0.16 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 31 0.28 At1g58190.1 68414.m06605 leucine-rich repeat family protein cont... 31 0.37 At1g51920.1 68414.m05853 expressed protein 31 0.49 At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S ... 30 0.65 At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) 30 0.65 At5g65130.1 68418.m08193 AP2 domain-containing transcription fac... 30 0.86 At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / th... 29 1.5 At2g26000.1 68415.m03122 zinc finger (C3HC4-type RING finger) fa... 28 3.5 At5g45640.1 68418.m05612 subtilase family protein contains Pfam ... 27 4.6 At1g77110.1 68414.m08981 auxin transport protein, putative simil... 27 6.1 At1g58350.1 68414.m06637 expressed protein contains Pfam profile... 27 6.1 At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / lon... 27 8.1 At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containi... 27 8.1 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 27 8.1 >At2g32060.3 68415.m03918 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 157 bits (382), Expect = 3e-39 Identities = 70/121 (57%), Positives = 96/121 (79%) Frame = -1 Query: 366 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCN 187 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALCA 83 Query: 186 EHQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYLKS 7 +H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L S Sbjct: 84 DHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHLDS 143 Query: 6 S 4 + Sbjct: 144 N 144 >At2g32060.2 68415.m03917 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 157 bits (382), Expect = 3e-39 Identities = 70/121 (57%), Positives = 96/121 (79%) Frame = -1 Query: 366 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCN 187 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALCA 83 Query: 186 EHQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYLKS 7 +H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L S Sbjct: 84 DHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHLDS 143 Query: 6 S 4 + Sbjct: 144 N 144 >At2g32060.1 68415.m03916 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 157 bits (382), Expect = 3e-39 Identities = 70/121 (57%), Positives = 96/121 (79%) Frame = -1 Query: 366 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCN 187 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALCA 83 Query: 186 EHQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYLKS 7 +H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L S Sbjct: 84 DHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHLDS 143 Query: 6 S 4 + Sbjct: 144 N 144 >At1g15930.2 68414.m01912 40S ribosomal protein S12 (RPS12A) similar to 40S ribosomal protein S12 GI:4263712 from [Arabidopsis thaliana] Length = 144 Score = 149 bits (362), Expect = 7e-37 Identities = 71/137 (51%), Positives = 96/137 (70%), Gaps = 1/137 (0%) Frame = -1 Query: 414 ADVEVEVPT-NPILSGNNMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLA 238 A V V P P +MD+ AL+ L+ A +GG+V GLHE AK ++KR A L VLA Sbjct: 7 APVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLA 66 Query: 237 ENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKD 58 E+C++ Y KLV+ALC +H++ L+ V + K LGEWAGLCKID +G ARK+VGCSC+V+KD Sbjct: 67 EDCNQPDYVKLVKALCADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKD 126 Query: 57 FGEETPALDVLKDYLKS 7 FGEET AL ++ ++ S Sbjct: 127 FGEETTALSIVNKHIAS 143 >At1g15930.1 68414.m01911 40S ribosomal protein S12 (RPS12A) similar to 40S ribosomal protein S12 GI:4263712 from [Arabidopsis thaliana] Length = 144 Score = 149 bits (362), Expect = 7e-37 Identities = 71/137 (51%), Positives = 96/137 (70%), Gaps = 1/137 (0%) Frame = -1 Query: 414 ADVEVEVPT-NPILSGNNMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLA 238 A V V P P +MD+ AL+ L+ A +GG+V GLHE AK ++KR A L VLA Sbjct: 7 APVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLA 66 Query: 237 ENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKD 58 E+C++ Y KLV+ALC +H++ L+ V + K LGEWAGLCKID +G ARK+VGCSC+V+KD Sbjct: 67 EDCNQPDYVKLVKALCADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKD 126 Query: 57 FGEETPALDVLKDYLKS 7 FGEET AL ++ ++ S Sbjct: 127 FGEETTALSIVNKHIAS 143 >At5g08180.1 68418.m00955 ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein Similar to NHP2/L7Ae family proteins, see SWISSPROT:P32495 and PMID:2063628. Length = 156 Score = 32.3 bits (70), Expect = 0.16 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = -1 Query: 306 LVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLGEWAG 127 L G+ E K++ + Q LCV+A N + LC E +P V V + + L + AG Sbjct: 51 LKRGVKEVVKSIRRGQKGLCVIAGNISPIDVITHLPILCEEAGVPYVYVPSKEDLAQ-AG 109 Query: 126 LCK 118 K Sbjct: 110 ATK 112 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 31.5 bits (68), Expect = 0.28 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = -1 Query: 336 VLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVD 157 V+K G L +GL + K + + + L E+ ++ +KK+ + P+++ Sbjct: 1364 VVKLVAEDGSLRNGLEFSEK--ESTVSKMLKLDESKEKEEHKKIRKPTEERSNAPVIEKQ 1421 Query: 156 NNKKLGEWAGLCKIDKDGKARKIVG 82 NKK E KID+ GK ++I G Sbjct: 1422 GNKKNAEEEMQDKIDRRGKNQEIKG 1446 >At1g58190.1 68414.m06605 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1784 Score = 31.1 bits (67), Expect = 0.37 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = -1 Query: 333 LKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDN 154 LKT ++HG + G + ++ R L L++N + V L N H + + + + Sbjct: 1008 LKTLILHGNNMEGTFPMKELINLRNLELLDLSKN----QFVGPVPDLANFHNLQGLDMSD 1063 Query: 153 NKKLGEWAGLCKI 115 NK G GLC++ Sbjct: 1064 NKFSGSNKGLCQL 1076 >At1g51920.1 68414.m05853 expressed protein Length = 78 Score = 30.7 bits (66), Expect = 0.49 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +3 Query: 96 LPCHPCQSCRDQPILQAFCCCQP*PVESDVRCTEPEQVSCMRLHHSSQP 242 +P P S R PI A CC+P P+ S RC V+ HHS P Sbjct: 33 IPRAPISSRR--PICPACVCCEPAPLGSCCRCCASPIVT-QTHHHSQSP 78 >At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S RIBOSOMAL PROTEIN L7A - Oryza sativa, SWISSPROT:RL7A_ORYSA Length = 256 Score = 30.3 bits (65), Expect = 0.65 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -1 Query: 300 HGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLG 139 +GL+ +++ +A L V+A + D + ALC + ++P V +LG Sbjct: 128 YGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLG 181 >At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) Length = 257 Score = 30.3 bits (65), Expect = 0.65 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -1 Query: 300 HGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLG 139 +GL+ +++ +A L V+A + D + ALC + ++P V +LG Sbjct: 129 YGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLG 182 >At5g65130.1 68418.m08193 AP2 domain-containing transcription factor, putative similar to AP2 domain transcription factor Length = 277 Score = 29.9 bits (64), Expect = 0.86 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 204 VQALCNEHQIPLVKVDNNKKLGE-WAGLCKIDKDGKARKIVGC 79 ++++CN +PL +++ K E +G K +K+ + +I GC Sbjct: 187 IESICNSSDLPLPQIEKQNKTEEVLSGFSKPEKEPEFGEIYGC 229 >At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative similar to SP|O04630 Threonyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) {Arabidopsis thaliana}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain, PF02824: TGS domain Length = 458 Score = 29.1 bits (62), Expect = 1.5 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 273 LDKRQAVLCVLAENCDEAAYKKLVQALCNE 184 L RQA++C L+E+C ++Y K VQ NE Sbjct: 355 LSPRQAIVCSLSEDC--SSYAKQVQKQINE 382 >At2g26000.1 68415.m03122 zinc finger (C3HC4-type RING finger) family protein similar to BRCA1-associated protein 2 [Homo sapiens] GI:3252872; contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF02148: Zn-finger in ubiquitin-hydrolases and other protein Length = 461 Score = 27.9 bits (59), Expect = 3.5 Identities = 20/72 (27%), Positives = 25/72 (34%) Frame = +3 Query: 102 CHPCQSCRDQPILQAFCCCQP*PVESDVRCTEPEQVSCMRLHHSSQPKHIVLLASCQEL* 281 C C+ C+ QP C CQ E+ C V C R +H C L Sbjct: 203 CPVCRYCQQQPENSVCCVCQ--TTENLWMCVICGVVGCGRYKEGHARRHWEETEHCYSL- 259 Query: 282 RLREDRAQDHHG 317 L R D+ G Sbjct: 260 ELETQRVWDYAG 271 >At5g45640.1 68418.m05612 subtilase family protein contains Pfam domain, PF00082: Subtilase family; contains Pfam domain, PF02225: protease associated (PA) domain Length = 754 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 249 IVLLASCQEL*RLREDRAQDHHGLKLSLAP 338 + LLASC + +LRE+RA +G L P Sbjct: 18 VPLLASCTKEKQLREERASSINGFAAELTP 47 >At1g77110.1 68414.m08981 auxin transport protein, putative similar to auxin transport protein EIR1 GI:3377507 from [Arabidopsis thaliana] Length = 570 Score = 27.1 bits (57), Expect = 6.1 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 118 LAETSPFSKLFVVVNLDQWNLMFVAQSLNKFLVCGFITVLSQNT*YCLPLVKSFSG 285 LA+T SK+FV V L W + F A L+ + I L +PL+++ G Sbjct: 73 LADT--LSKIFVFVLLSLWAVFFKAGGLDWLITLFSIATLPNTLVMGIPLLQAMYG 126 >At1g58350.1 68414.m06637 expressed protein contains Pfam profile PF05057: Protein of unknown function (DUF676); supporting cDNA gi|6520166|dbj|AB028199.1| Length = 794 Score = 27.1 bits (57), Expect = 6.1 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 242 WLRTVMKPHTRNLFRLCATNIRFHWSRL 159 WL + K H +F L T + + W+ L Sbjct: 327 WLHELSKDHLSRIFHLLGTQLHYLWNTL 354 >At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl-CoA synthetase (MF7P) from Brassica napus [gi:1617270] Length = 666 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 338 SCSATFTSMLLPDKMGLVGT 397 SC+ TF S LPD++G++GT Sbjct: 423 SCAGTFVS--LPDELGMLGT 440 >At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 603 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 153 NKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEE 46 NKK L K+ KD KA K+ GCS + + + E Sbjct: 446 NKKWEYVDSLRKVMKDRKAVKVPGCSSIEVNNVVHE 481 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 26.6 bits (56), Expect = 8.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 311 PWIKAVFSTSCSATFTSMLLPDKMGLVGTSTS 406 PW+K + +TS S+ +S LP+ + + G S S Sbjct: 134 PWLKHLSTTSSSSASSSSRLPNYLYIPGGSIS 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,707,572 Number of Sequences: 28952 Number of extensions: 215328 Number of successful extensions: 680 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -