BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o04r (752 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar... 33 0.058 SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 26 6.6 >SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 32.7 bits (71), Expect = 0.058 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = -3 Query: 507 MRNLVSYLKQKEAAGVISLLNKETEA----TGVLYSFPPCEFSTDLLKRTCHNLTEE 349 +RN S LK G L ET+A GV F PC+ +TD +K CH + +E Sbjct: 389 LRNYDSSLKPDYVVGDFDSLTDETKAYYKEMGVNIVFDPCQNTTDFMK--CHKIIKE 443 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/16 (62%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -2 Query: 145 CCVLTVIRIN-FDENV 101 CC++T+IRIN F +NV Sbjct: 499 CCIMTIIRINYFVDNV 514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,927,406 Number of Sequences: 5004 Number of extensions: 58368 Number of successful extensions: 134 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -