BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10o02r (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 61 7e-10 SB_39674| Best HMM Match : Recep_L_domain (HMM E-Value=7.1) 29 3.6 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 61.3 bits (142), Expect = 7e-10 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 683 VGVNVPIPVPLSMFSFSGTRGSFLGTNHFCGKQ 585 +G+NVPIPVPL MFSF+G+RGSFLG +HF GKQ Sbjct: 1 IGINVPIPVPLPMFSFTGSRGSFLGDSHFYGKQ 33 >SB_39674| Best HMM Match : Recep_L_domain (HMM E-Value=7.1) Length = 390 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -2 Query: 493 HNNSLIKKKKVLISFELFEEGFCTIFFK 410 +N+S + KKVL SF+ E+G C + F+ Sbjct: 231 NNSSRVVLKKVLDSFKYIEDGLCYVNFR 258 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,762,212 Number of Sequences: 59808 Number of extensions: 386727 Number of successful extensions: 791 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -