BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n24r (771 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IJU7 Cluster: Putative uncharacterized protein; n=1; ... 35 1.9 UniRef50_P75800 Cluster: Uncharacterized protein yliE; n=22; cel... 34 4.5 UniRef50_Q7N071 Cluster: Similarities with the central region of... 33 5.9 UniRef50_A7R6Y3 Cluster: Chromosome undetermined scaffold_1484, ... 33 7.9 UniRef50_A2FN80 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 >UniRef50_Q8IJU7 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1345 Score = 35.1 bits (77), Expect = 1.9 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +1 Query: 28 YKYCFFLLITKSLMLLIFTNAPRIYANNFYMKK-TIVDSNMIYTGNTIFHNYK*TNKWTS 204 Y +F+ I +LL Y NN+Y V + MIY+ IF N TN WT Sbjct: 115 YSNIYFVCINTLFLLLNNITQNNNYHNNYYHNNYNDVINCMIYSCFDIFFNLISTNNWTR 174 Query: 205 FRL*ISLIK*INF 243 L I + +NF Sbjct: 175 KNLHIQIFSKLNF 187 >UniRef50_P75800 Cluster: Uncharacterized protein yliE; n=22; cellular organisms|Rep: Uncharacterized protein yliE - Escherichia coli (strain K12) Length = 782 Score = 33.9 bits (74), Expect = 4.5 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -2 Query: 719 FTLHI*DDDDKFIISQPIY*SLPWWYCR*YLNVTSVNNDVYYLK 588 FTLHI D + I+ L W Y YL+ S N++V +LK Sbjct: 177 FTLHINGKDHDLLAVDKIHVDLNWRYLNEYLDQISANDEVLFLK 220 >UniRef50_Q7N071 Cluster: Similarities with the central region of DNA-directed RNA polymerase; n=1; Photorhabdus luminescens subsp. laumondii|Rep: Similarities with the central region of DNA-directed RNA polymerase - Photorhabdus luminescens subsp. laumondii Length = 831 Score = 33.5 bits (73), Expect = 5.9 Identities = 23/67 (34%), Positives = 36/67 (53%) Frame = -2 Query: 230 LIKLIYSRNDVHLFVYL*L*NIVLPVYIMFESTIVFFI*KLFA*IRGALVKISNIKDFVI 51 +I L+ S + +Y+ I LP+ E + + I L A +R AL I+NI F+I Sbjct: 25 VINLLSSFFSFSILIYI----ITLPLTNSLEESSIGLIIFLIAILRPALSVINNISLFLI 80 Query: 50 NKKKQYL 30 NKK+ Y+ Sbjct: 81 NKKQAYI 87 >UniRef50_A7R6Y3 Cluster: Chromosome undetermined scaffold_1484, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome undetermined scaffold_1484, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 218 Score = 33.1 bits (72), Expect = 7.9 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 163 CCLCISCLNPLLSSSYKNCLHKFV 92 CCL ISC + LS+S NC HK V Sbjct: 38 CCLIISCQDSQLSASPLNCRHKLV 61 >UniRef50_A2FN80 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1092 Score = 33.1 bits (72), Expect = 7.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 61 SLMLLIFTNAPRIYANNFYMKKTIVDSNMIYTGNTIFHN 177 S +LLIF P+I +F + DSN++Y +TI +N Sbjct: 936 SAILLIFRKYPQIVNQDFGLHFEYTDSNLVYRNSTIHYN 974 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,173,006 Number of Sequences: 1657284 Number of extensions: 11004031 Number of successful extensions: 22732 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22715 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64615845515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -