BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n24r (771 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92782-3|CAB07189.2| 326|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z70683-2|CAA94592.2| 717|Caenorhabditis elegans Hypothetical pr... 29 4.8 >Z92782-3|CAB07189.2| 326|Caenorhabditis elegans Hypothetical protein F14F8.4 protein. Length = 326 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 254 VNYLKFIYLIKLIYSRNDVHLFVYL*L*NIVLPVYIMFESTIVFF 120 +N LK+++ +YS+N +H +V IVL + F +V F Sbjct: 127 LNSLKYLFPFNSVYSQNSIHKYVRHFSVAIVLKDVLFFSPLLVHF 171 >Z70683-2|CAA94592.2| 717|Caenorhabditis elegans Hypothetical protein F13B12.3 protein. Length = 717 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 398 LTVILFNNTHIMEVILLNSPAVKLHKMFKRRKKVSHINWSF 520 + V LF + V+L+N L K ++ KVSHI W + Sbjct: 534 IPVFLFCYMLVSSVLLVNLVTALLSKKYEDIDKVSHIYWKY 574 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,771,922 Number of Sequences: 27780 Number of extensions: 286853 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -