BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n22r (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 28 1.7 SPAC1952.15c |rec24|mug6|meiotic recombination protein Rec24|Sch... 27 2.2 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 27.9 bits (59), Expect = 1.7 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = -2 Query: 204 LQHTCSQY---CA-KQYVNVFSIYLKNFEY 127 L H C QY CA Q+ VF +YLKN+ + Sbjct: 889 LSHRCFQYMVLCAIVQFSGVFFLYLKNYNF 918 >SPAC1952.15c |rec24|mug6|meiotic recombination protein Rec24|Schizosaccharomyces pombe|chr 1|||Manual Length = 350 Score = 27.5 bits (58), Expect = 2.2 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 419 NNKYREIKDRVRIYVFFKVICESEDFVRILTLF--LKMFHKNDC 544 N +R +K I + + E DF+RI TLF + MF K DC Sbjct: 138 NGLFRFLKCTADIKLKQTKVYEGADFLRIKTLFEEIFMFLKRDC 181 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,922,315 Number of Sequences: 5004 Number of extensions: 60172 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -