BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n22r (760 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70211-4|CAA94159.1| 825|Caenorhabditis elegans Hypothetical pr... 31 0.89 U23510-3|AAC46782.1| 340|Caenorhabditis elegans Hypothetical pr... 29 2.7 AC024857-3|AAK31568.6| 611|Caenorhabditis elegans Hypothetical ... 29 3.6 >Z70211-4|CAA94159.1| 825|Caenorhabditis elegans Hypothetical protein K11E4.4 protein. Length = 825 Score = 31.1 bits (67), Expect = 0.89 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +2 Query: 500 RILTLFLKMFHKNDCIDVP*LL*KKCHLKSDYNTTCDIVFSH*NCIISKLTNFTGECFKG 679 +IL + L +F +D+ + ++ +L Y CD+VF +C I + T CF G Sbjct: 59 KILMILLTIFILIFSLDIVYVCTRQIYLAFSYENDCDLVFETASCSIFRRIALT--CFVG 116 Query: 680 LTCDIF 697 +T F Sbjct: 117 VTTTQF 122 >U23510-3|AAC46782.1| 340|Caenorhabditis elegans Hypothetical protein R12C12.3 protein. Length = 340 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 425 YYCYQLRTW*FIKKIFIYLLGSMVFFFKY 339 Y Y+L++W ++ IFI LLG+ F Y Sbjct: 4 YEFYELKSWMYLPVIFIGLLGNFASFLVY 32 >AC024857-3|AAK31568.6| 611|Caenorhabditis elegans Hypothetical protein Y71G12A.2 protein. Length = 611 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 99 FNIIYKTFSYTQSSSSKC 152 +NI YK F+Y +SS+SKC Sbjct: 514 WNITYKLFNYLRSSNSKC 531 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,921,571 Number of Sequences: 27780 Number of extensions: 332784 Number of successful extensions: 650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -