BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n22r (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 3.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 3.1 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 4.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.5 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 39 NKNKTSHTVHYGSKYSNLTFFNII 110 N N ++ +Y + Y L ++NII Sbjct: 95 NNNYNNYNNNYNTNYKKLQYYNII 118 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 54 SHTVHYGSKYSNLTFFNIIY 113 ++T+H + Y L ++NI Y Sbjct: 309 NNTIHNNNNYKKLQYYNINY 328 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 54 SHTVHYGSKYSNLTFFNIIY 113 ++T+H + Y L ++NI Y Sbjct: 320 NNTIHNNNNYKKLQYYNINY 339 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 54 SHTVHYGSKYSNLTFFNIIY 113 ++T+H + Y L ++NI Y Sbjct: 320 NNTIHNNNNYKKLQYYNINY 339 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 54 SHTVHYGSKYSNLTFFNIIY 113 ++T+H + Y L ++NI Y Sbjct: 309 NNTIHNNNNYKKLQYYNINY 328 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -3 Query: 542 NHFCETSLKIKSRYAQNLHFHKSL*KKHRFSLGLLSLYIYYCY 414 NH T S + + L FH + +K +LG++ C+ Sbjct: 343 NHLNSTCSVTNSPHQKKLRFHLAKERKASTTLGIIMSAFIVCW 385 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 620 RRRCHTLCCNQILNDIFFRVIKER 549 R + + CC++ DIFF + R Sbjct: 210 RHKKYYPCCDEPYPDIFFNITLRR 233 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,081 Number of Sequences: 438 Number of extensions: 3734 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -