BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n22r (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19330.1 68417.m02848 kelch repeat-containing F-box family pr... 29 2.5 At2g14570.1 68415.m01632 SWIM zinc finger family protein 28 5.9 >At4g19330.1 68417.m02848 kelch repeat-containing F-box family protein very low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 537 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/81 (28%), Positives = 38/81 (46%) Frame = -3 Query: 620 RRRCHTLCCNQILNDIFFRVIKERLYNHFCETSLKIKSRYAQNLHFHKSL*KKHRFSLGL 441 +RR + CNQ+ +DI ++ R+ + +T L + S+ + L K L R LG Sbjct: 168 KRRRSIVACNQLADDIVLNIL-ARISTSYYQT-LSLVSKTFRLLILSKEL-DMERSYLGT 224 Query: 440 LSLYIYYCYQLRTW*FIKKIF 378 +Y C Q T F ++ F Sbjct: 225 RKPCVYVCLQSPTHPFDRRWF 245 >At2g14570.1 68415.m01632 SWIM zinc finger family protein Length = 435 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +2 Query: 428 YREIKDRVRIYV---FFKVICESEDFVRILTLFLKMFHKND 541 Y + KDR +++ FK++C+ VR+L +FL+ +ND Sbjct: 70 YEDSKDRRQLFEKDNSFKMMCDGGRCVRVLNVFLEESTEND 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,162,272 Number of Sequences: 28952 Number of extensions: 272108 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -