BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n19r (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 3.0 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 3.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.9 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 9.1 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 9.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.1 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 21 9.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.1 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.0 bits (47), Expect = 3.0 Identities = 18/78 (23%), Positives = 33/78 (42%) Frame = -1 Query: 484 SCSRQETCAHRFRNRLQHSRWNWYSRLHTRHGFG*RACSRVKFTQPNPYQTKGLQSGYRQ 305 SCSR ++ ++R N +L + SR + + N Y+ + YR+ Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKL-LEERTSRKRYSRSREREQNSYKNEKEYRKYRE 61 Query: 304 RSFSQRISERIRKSHKSQ 251 RS + +R R+ K + Sbjct: 62 RSKERSRDKRERERSKER 79 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.0 bits (47), Expect = 3.0 Identities = 18/78 (23%), Positives = 33/78 (42%) Frame = -1 Query: 484 SCSRQETCAHRFRNRLQHSRWNWYSRLHTRHGFG*RACSRVKFTQPNPYQTKGLQSGYRQ 305 SCSR ++ ++R N +L + SR + + N Y+ + YR+ Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKL-LEERTSRKRYSRSREREQNSYKNEKEYRKYRE 61 Query: 304 RSFSQRISERIRKSHKSQ 251 RS + +R R+ K + Sbjct: 62 RSKERSRDKRERERSKER 79 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 515 SSPTSCHSSRKLLSARNLCSPFSEPTTTL 429 SS +S +SS S+ + C+P +PT L Sbjct: 953 SSSSSFYSSFLYKSSESSCNPDQKPTEYL 981 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 405 YIHVMDLASGHVAALNLLSQTHIRLKVYNLG 313 Y HV + +S + L+ + TH VY LG Sbjct: 272 YPHVPEYSSSIIMELHNIEGTHYVKIVYYLG 302 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 405 YIHVMDLASGHVAALNLLSQTHIRLKVYNLG 313 Y HV + +S + L+ + TH VY LG Sbjct: 287 YPHVPEYSSSIIMELHNIEGTHYVKIVYYLG 317 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 157 SINYRRDVYGFLAMAD 110 +INYR + GFL+ D Sbjct: 155 TINYRLGILGFLSTED 170 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 157 SINYRRDVYGFLAMAD 110 +INYR + GFL+ D Sbjct: 26 TINYRLGILGFLSTED 41 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 157 SINYRRDVYGFLAMAD 110 +INYR + GFL+ D Sbjct: 155 TINYRLGILGFLSTED 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,763 Number of Sequences: 438 Number of extensions: 5193 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -