BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n18f (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 112 2e-27 AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced prot... 44 2e-06 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 27 0.20 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 24 1.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.9 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 1.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 112 bits (270), Expect = 2e-27 Identities = 54/74 (72%), Positives = 63/74 (85%) Frame = +3 Query: 411 VRFGRVPKREKARILAAMQQSSSSRAHEQAAAAELDDAPRLLARVVRAHLDTCEFTRDRV 590 VRFGRVPKREKARILAAMQQSS SR+ E+A AAEL+D RLLA VV+AHLDTC+FTRD+V Sbjct: 138 VRFGRVPKREKARILAAMQQSSHSRSQEKAVAAELEDEQRLLATVVQAHLDTCDFTRDKV 197 Query: 591 ASMRARARDCPTYS 632 A + RAR+ P Y+ Sbjct: 198 APILVRARETPNYT 211 >AB264336-1|BAF44091.1| 21|Apis mellifera ecdysone-induced protein 75 protein. Length = 21 Score = 43.6 bits (98), Expect = 2e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +3 Query: 345 MGEDLPILKGILNGVVKYHNA 407 MG++LPILKGILNGVV YHNA Sbjct: 1 MGDELPILKGILNGVVNYHNA 21 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 26.6 bits (56), Expect = 0.20 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 565 RASSRVIASLPCEPELATVPPTRSL 639 R+ V+ S CEP++ V PTR L Sbjct: 261 RSVDLVVTSTYCEPQVVIVSPTREL 285 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 249 SASINIVRITVTIISGHWL*T 311 SA +++V +TV I +G WL T Sbjct: 59 SAMLSLVVVTVAISTGEWLLT 79 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +3 Query: 351 EDLPILKGILNGVVK-----YHNAPVRFG 422 EDLP +K I V+K + + P RFG Sbjct: 350 EDLPFIKDIYETVIKLEGASFRSKPYRFG 378 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +3 Query: 351 EDLPILKGILNGVVK-----YHNAPVRFG 422 EDLP +K I V+K + + P RFG Sbjct: 56 EDLPFIKDIYETVIKLEGASFRSKPYRFG 84 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +2 Query: 89 ERETLSQ*SLWCSPLTTPRCSDIRSHWIATLLFTD 193 E+ LS + SP+T+ + + +R+H +T T+ Sbjct: 319 EKPVLSSSTTTTSPMTSTKSTIVRNHLNSTCSVTN 353 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,559 Number of Sequences: 438 Number of extensions: 2878 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -