BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n17r (459 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L06498-1|AAA60286.1| 119|Homo sapiens ribosomal protein S20 pro... 180 2e-45 BC087850-1|AAH87850.1| 119|Homo sapiens ribosomal protein S20 p... 180 2e-45 BC007507-1|AAH07507.1| 119|Homo sapiens ribosomal protein S20 p... 180 2e-45 AB061842-1|BAB79480.1| 119|Homo sapiens ribosomal protein S20 p... 180 2e-45 AB007156-1|BAA25820.1| 60|Homo sapiens ribosomal protein S20 p... 122 4e-28 >L06498-1|AAA60286.1| 119|Homo sapiens ribosomal protein S20 protein. Length = 119 Score = 180 bits (438), Expect = 2e-45 Identities = 88/107 (82%), Positives = 94/107 (87%), Gaps = 1/107 (0%) Frame = -2 Query: 335 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 159 KD K E IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI Sbjct: 4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63 Query: 158 TTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 TTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEP V Sbjct: 64 TTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 110 >BC087850-1|AAH87850.1| 119|Homo sapiens ribosomal protein S20 protein. Length = 119 Score = 180 bits (438), Expect = 2e-45 Identities = 88/107 (82%), Positives = 94/107 (87%), Gaps = 1/107 (0%) Frame = -2 Query: 335 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 159 KD K E IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI Sbjct: 4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63 Query: 158 TTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 TTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEP V Sbjct: 64 TTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 110 >BC007507-1|AAH07507.1| 119|Homo sapiens ribosomal protein S20 protein. Length = 119 Score = 180 bits (438), Expect = 2e-45 Identities = 88/107 (82%), Positives = 94/107 (87%), Gaps = 1/107 (0%) Frame = -2 Query: 335 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 159 KD K E IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI Sbjct: 4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63 Query: 158 TTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 TTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEP V Sbjct: 64 TTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 110 >AB061842-1|BAB79480.1| 119|Homo sapiens ribosomal protein S20 protein. Length = 119 Score = 180 bits (438), Expect = 2e-45 Identities = 88/107 (82%), Positives = 94/107 (87%), Gaps = 1/107 (0%) Frame = -2 Query: 335 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 159 KD K E IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI Sbjct: 4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63 Query: 158 TTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 TTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEP V Sbjct: 64 TTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 110 >AB007156-1|BAA25820.1| 60|Homo sapiens ribosomal protein S20 protein. Length = 60 Score = 122 bits (295), Expect = 4e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -2 Query: 197 KGPVRMPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 KGPVRMPTK LRITTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEP V Sbjct: 1 KGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 60 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,803,835 Number of Sequences: 237096 Number of extensions: 1681579 Number of successful extensions: 3330 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3330 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3872123864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -