BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n17r (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S ... 158 2e-39 At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S ... 158 2e-39 At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribo... 156 8e-39 At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ... 156 8e-39 At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,... 48 2e-06 At1g20530.1 68414.m02558 hypothetical protein 29 1.1 At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2... 28 3.5 At3g06960.2 68416.m00827 expressed protein 28 3.5 At3g06960.1 68416.m00826 expressed protein 28 3.5 At3g18310.1 68416.m02330 expressed protein 27 6.1 At5g27220.1 68418.m03247 protein transport protein-related low s... 27 8.1 >At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 158 bits (383), Expect = 2e-39 Identities = 69/100 (69%), Positives = 87/100 (87%) Frame = -2 Query: 317 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 138 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 137 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEP V Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGV 113 >At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 158 bits (383), Expect = 2e-39 Identities = 69/100 (69%), Positives = 87/100 (87%) Frame = -2 Query: 317 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 138 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 137 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEP V Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGV 113 >At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribosomal protein S20, Arabidopsis thaliana, PIR:T12992 Length = 124 Score = 156 bits (378), Expect = 8e-39 Identities = 68/94 (72%), Positives = 84/94 (89%) Frame = -2 Query: 299 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 120 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 119 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 WDRF++R+HKRVIDL S ++VKQITSI IEP V Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGV 115 >At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ribsomomal proteinS20, Arabidopsis thaliana, pir:T12992 Length = 124 Score = 156 bits (378), Expect = 8e-39 Identities = 68/94 (72%), Positives = 84/94 (89%) Frame = -2 Query: 299 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKT 120 IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PCGEG+ T Sbjct: 22 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNT 81 Query: 119 WDRFQMRIHKRVIDLHSPSEIVKQITSINIEPPV 18 WDRF++R+HKRVIDL S ++VKQITSI IEP V Sbjct: 82 WDRFELRVHKRVIDLFSSPDVVKQITSITIEPGV 115 >At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast, putative similar to 30S ribosomal protein S10 GB:P02364 [Escherichia coli] (est matches suggest the N-terminal extension) Length = 191 Score = 48.4 bits (110), Expect = 2e-06 Identities = 29/98 (29%), Positives = 49/98 (50%) Frame = -2 Query: 356 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 177 A+ V S I +++P +IRI L S V +E C +++ A+ + GPV +P Sbjct: 73 ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132 Query: 176 TKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPS 63 TK K+P + F++R H+R+ID+ P+ Sbjct: 133 TKKRIYCVLKSPHVHKDARF-HFEIRTHQRMIDILYPT 169 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +2 Query: 77 GRSLSCGFSSENDPRSLNLHHKEFYGW*YAGSWLACGLGPLHAASVSW 220 G +C S + P SLNL+H FY Y + P ++ +W Sbjct: 106 GEGTNCDLLSGSKPESLNLNHDSFYSRRYESGTITPPPPPPAPSNYAW 153 >At5g47370.1 68418.m05838 homeobox-leucine zipper protein 2 (HAT2) / HD-ZIP protein 2 identical to homeobox-leucine zipper protein HAT2 (HD-ZIP protein 2) [Arabidopsis thaliana] SP:P46601; contains Pfam profiles PF04618: HD-ZIP protein N terminus, PF02183: Homeobox associated leucine zipper, PF00046: Homeobox domain Length = 283 Score = 27.9 bits (59), Expect = 3.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 65 RESVGRSLSCGFSSENDPRSLNLH 136 +E +G SLS GFS ++P +NL+ Sbjct: 5 KEDLGLSLSLGFSQNHNPLQMNLN 28 >At3g06960.2 68416.m00827 expressed protein Length = 341 Score = 27.9 bits (59), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 289 MRWIGETSAWGFSMSLPDT 345 MRW+GE W MS P T Sbjct: 4 MRWVGEGDIWDLDMSTPVT 22 >At3g06960.1 68416.m00826 expressed protein Length = 479 Score = 27.9 bits (59), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 289 MRWIGETSAWGFSMSLPDT 345 MRW+GE W MS P T Sbjct: 4 MRWVGEGDIWDLDMSTPVT 22 >At3g18310.1 68416.m02330 expressed protein Length = 873 Score = 27.1 bits (57), Expect = 6.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -1 Query: 225 WSQETEAACKGPSPHANQDPA 163 W+ +++ C GPSP +DP+ Sbjct: 400 WNAQSQMFCFGPSPSVGKDPS 420 >At5g27220.1 68418.m03247 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1181 Score = 26.6 bits (56), Expect = 8.1 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +3 Query: 249 LERAH--IA*SKSDPDAVDRGDLCL 317 ++R H +A +K DPD+V RG +CL Sbjct: 691 IQRLHEKMAVTKLDPDSVRRGSICL 715 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,470,459 Number of Sequences: 28952 Number of extensions: 225605 Number of successful extensions: 482 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -